💬 Support:🟢 WhatsApp | 🔵 Telegram | 📧 help@guru.markets

IRM 📈 Analysis and forecast of the company's shares 📉 Iron Mountain

The company's competitors:WELLDLRVICIEXRVTRSUIAREGLPIDOCELSOHICUBECTRECDPWHHRSBRAEPRNSACOLDNHIBNLMPWAPLEDBRGSHODRHIIPRSMASILAXHRSAFERLJDHCINNUHTGMREFPIPSTLSVCCHCTCLDTLANDSTRWSELFAHTIHTPWHTIBPRHE

GURU.Markets stock price, segment price, and overall market index valuation

The company's share price Iron Mountain

Iron Mountain started out storing paper archives and is now actively building data centers. Its stock chart is the story of its transformation from a custodian of physical information to a custodian of digital information. The company is capitalizing on its reputation for reliability in the new digital era.

Company stock price chart Iron Mountain

Share prices of companies in the market segment - Investors specialized

Iron Mountain is a leader in the storage and management of physical and digital archives. We classify it as a specialist investor. The chart below shows the overall dynamics of this unique business, which is transforming itself by building data centers for digital information storage.

Stock price chart of companies in the market segment - Investors specialized

Broad Market Index - GURU.Markets

Iron Mountain is a global leader in storing and managing information and assets, from physical documents to cloud data centers. Its unique business earns it a spot in the GURU.Markets index. The chart below represents the market. See how Iron Mountain shares compare to the overall trend.

Broad Market Index Chart - GURU.Markets

Change in the price of a company, segment, and market as a whole per day

IRM - Daily change in the company's share price Iron Mountain

Iron Mountain is a leader in physical archive and data storage, and its business is considered stable. Its daily share price fluctuations indicate moderate volatility but sensitivity to interest rates. This metric, while unspectacular, is an important element in the formulas at System.GURU.Markets, where it helps assess risk.

Daily change chart of the company's share price Iron Mountain

Daily change in the price of a set of shares in a market segment - Investors specialized

Data and document storage is a unique niche in the REIT sector, where Iron Mountain is a leader. This chart shows the average daily volatility of specialized real estate investment trusts. Comparison with IRM's performance helps understand how resilient its business is to economic cycles.

Graph of daily price changes for a set of shares in a market segment - Investors specialized

Daily change in the price of a broad market stock, index - GURU.Markets

Iron Mountain is a leader in the storage and management of physical and digital data. Its business, based on long-term contracts, is considered relatively stable. The chart below shows the overall market volatility, which may make Iron Mountain appear more secure.

Daily chart of changes in the price of broad market stocks, index - GURU.Markets

Dynamics of market capitalization of the company, segment and the market as a whole over 12 months

Annual dynamics of the company's market capitalization Iron Mountain

Iron Mountain is a global leader in physical archive and data storage. Its year-over-year performance reflects the stability of its core business and successful growth in the data center segment, as recognized by investors.

Chart of the annual dynamics of the company's market capitalization Iron Mountain

Annual dynamics of market capitalization of the market segment - Investors specialized

Iron Mountain Incorporated is a global leader in the storage and management of information, both physical and digital. The company is actively expanding its data center business. The chart below shows how this transformation toward digital services impacts its valuation compared to traditional REITs.

Graph of annual dynamics of market capitalization of a market segment - Investors specialized

Annual dynamics of market capitalization of broad market stocks, index - GURU.Markets

Iron Mountain is a global leader in storing and managing physical and digital data. Its document storage business generates stable revenue, while its growing data center business drives growth. This hybrid model gives the company's shares both defensive and growth qualities.

Chart of the annual dynamics of the market capitalization of broad market stocks, index - GURU.Markets

Dynamics of market capitalization of the company, segment and the market as a whole for the month

Monthly dynamics of the company's market capitalization Iron Mountain

Iron Mountain's value reflects its transformation from a custodian of paper-based archives to a data center operator. The monthly fluctuations on the chart reflect the balance between its stable but slowly growing core business and its more dynamic data center segment, which follows the trends of cloud computing and digitalization.

Chart of monthly dynamics of the company's market capitalization Iron Mountain

Monthly dynamics of market capitalization of the market segment - Investors specialized

This chart shows the dynamics of the real estate (REIT) sector, particularly the data storage segment, where Iron Mountain is a leader. Its movements reflect both the stable demand for physical document storage and the growth of the data center segment.

Chart of monthly dynamics of market capitalization of a market segment - Investors specialized

Monthly dynamics of market capitalization of broad market stocks, index - GURU.Markets

Iron Mountain is a leader in the storage and management of physical and digital data. The company's business generates stable revenue because its clients constantly need to store their archives. A graph of the overall market performance allows us to verify whether investors truly perceive Iron Mountain as a safe haven asset, less susceptible to general economic fluctuations.

Chart of monthly dynamics of market capitalization of broad market stocks, index - GURU.Markets

Dynamics of market capitalization of the company, segment and the market as a whole for the week

Weekly dynamics of the company's market capitalization Iron Mountain

Iron Mountain, a leader in information storage and management, combines the stability of physical archives with the growth of digital data centers. Weekly stock fluctuations reflect both trends in the commercial real estate market and the growing demand for cloud services and data protection, creating a unique investment profile.

Chart of the weekly dynamics of the company's market capitalization Iron Mountain

Weekly dynamics of market capitalization of the market segment - Investors specialized

Iron Mountain, a unique REIT that combines physical document storage and data centers, is exposed to multiple sectors. This chart compares its performance with that of specialized REITs to see how its hybrid model responds to broader real estate and digitalization trends compared to more niche players.

Weekly market capitalization dynamics chart for a market segment - Investors specialized

Weekly dynamics of market capitalization of stocks of the broad market, index - GURU.Markets

Iron Mountain is a leader in physical archive and data storage. Its business model is based on long-term contracts, ensuring stable revenue. The chart will show whether the company's shares act as a safe haven, demonstrating lower volatility than the broader market.

Weekly market capitalization chart of broad market stocks, index - GURU.Markets

Market capitalization of the company, segment and market as a whole

IRM - Market capitalization of the company Iron Mountain

Iron Mountain's stock isn't just a company valuation, but a financial embodiment of the value of information and memory. Its market capitalization reflects trust in its ability to securely store everything from paper archives to cloud data. The growth on the chart reflects the growing demand for secure management of the 21st century's most important asset—information.

Company market capitalization chart Iron Mountain

IRM - Share of the company's market capitalization Iron Mountain within the market segment - Investors specialized

Iron Mountain is a global leader in information storage and management, from physical archives to data centers. Its stake in specialized REITs reflects the uniqueness of its business and the trust of thousands of companies. The chart clearly demonstrates the company's importance as the custodian of corporate memory worldwide.

Company Market Capitalization Share Chart Iron Mountain within the market segment - Investors specialized

Market capitalization of the market segment - Investors specialized

Iron Mountain is a global leader in storing and managing information, from paper archives to data centers. The chart below shows the total market capitalization of this unique sector. Its dynamics reflect the growing value of data and the need for its secure storage.

Market segment market capitalization chart - Investors specialized

Market capitalization of all companies included in a broad market index - GURU.Markets

Information is the new oil, and storing it is a multi-billion dollar business. Iron Mountain's chart shows the market value of trust and security in managing physical and digital archives. Its share of the global economy reflects how valuable secure data storage is to global businesses.

A chart of the market capitalization of all companies included in the broad market index. - GURU.Markets

Book value capitalization of the company, segment and market as a whole

IRM - Book value capitalization of the company Iron Mountain

Iron Mountain builds data fortresses. Its book value is its global network of secure storage facilities and data centers. The chart below maps the growth of its physical empire. Each rise in the chart signifies the addition of a new asset, cementing its dominance in the world of information management.

Company balance sheet capitalization chart Iron Mountain

IRM - Share of the company's book capitalization Iron Mountain within the market segment - Investors specialized

Iron Mountain's business is physical security. The company owns thousands of highly secure storage facilities for documents, data, and valuables worldwide. The sector share chart literally shows the percentage of the global physical security and storage market controlled by this unique "fortress."

Chart of the company's book capitalization share Iron Mountain within the market segment - Investors specialized

Market segment balance sheet capitalization - Investors specialized

The specialized REIT sector, as the chart shows, is a world built of concrete and steel. Iron Mountain is a unique player in this space. Its business is capital-intensive, but its assets are not warehouses, but highly secure fortresses for storing information, creating a unique and difficult-to-copy business model.

Market segment balance sheet capitalization chart - Investors specialized

Book value of all companies included in the broad market index - GURU.Markets

Iron Mountain is a physical fortress for storing the world's most valuable assets, from documents to data. Their domain consists of thousands of secure vaults, literally dug into the ground. The graph below illustrates the colossal share of the physical world this "citadel of security and memory" occupies.

Chart of book value of all companies included in the broad market index - GURU.Markets

The ratio of market capitalization to book capitalization of a company, segment, and the market as a whole

Market capitalization to book capitalization ratio - Iron Mountain

Iron Mountain is a REIT, but with unique assets. Its book value comes from its secure document storage facilities and data centers. The market pays a premium for its dominant position, its "sticky" business (customers find it difficult to relocate), and its transition to the digital world.

Market to Book Capitalization Ratio Chart - Iron Mountain

Market to book capitalization ratio in a market segment - Investors specialized

Iron Mountain is a data storage business based on a network of secure data centers. Its market valuation is closely tied to the value of these physical assets. This chart shows whether the company trades at a premium or discount to its assets, reflecting investor confidence in the reliability and demand for its services.

Market to book capitalization ratio chart for a market segment - Investors specialized

Market to book capitalization ratio for the market as a whole

Iron Mountain is a global leader in information storage and management, from physical archives to cloud data. The company's business is built on owning and managing a vast network of secure storage facilities—its core asset. This metric reflects the market's appreciation of this unique real estate portfolio, its stable cash flow, and its growth potential in the digital age.

Market to book capitalization ratio chart for the overall market

Debts of the company, segment and market as a whole

IRM - Company debts Iron Mountain

Iron Mountain, a global leader in information storage and management, has a debt strategy that reflects its transition from physical archives to digital data centers. The company is actively raising capital to build and acquire data centers worldwide. This chart shows the scale of investment required to transform the business into the digital age.

Company debt schedule Iron Mountain

Market segment debts - Investors specialized

Iron Mountain is a global leader in information storage and management, including physical archives and data centers. Its business model, particularly in the data center segment, requires significant capital investment. This chart illustrates how the company uses debt financing to expand its global infrastructure, a strategy typical of specialized REITs.

Market segment debt schedule - Investors specialized

Market debt in general

Iron Mountain is a global leader in data storage and asset management, operating as a REIT. Its business requires ongoing investment in secure storage facilities and data centers. The chart below provides an overview of how the company utilizes debt financing to expand its global network, given overall trends in the credit markets.

Market debt chart as a whole

Debt to book value of the company, segment and market as a whole

The company's debt to book capitalization ratio Iron Mountain

Iron Mountain, a data and document storage company, is essentially a REIT-like real estate investment company. This chart reflects its reliance on debt to expand its storage network. Debt levels are a key metric for assessing the risks associated with rising interest rates and changing demand for physical storage.

A graph of a company's debt to book value Iron Mountain

Market segment debt to market segment book capitalization - Investors specialized

Iron Mountain is a global leader in data and asset management. This chart shows how the specialized real estate investment trust (REIT) sector uses debt. For asset-based companies, this is a key metric reflecting the growth strategy and leverage of Iron Mountain and its competitors.

Market segment debt to market segment book value graph - Investors specialized

Debt to book value of all companies in the market

Iron Mountain is a REIT specializing in document and data storage. This chart shows the overall debt level in the market. It helps assess how Iron Mountain's strategy of using debt to acquire and build secure storage facilities compares to overall credit market conditions and the state of the economy.

Debt to book value chart of all companies in the market

P/E of the company, segment and market as a whole

P/E - Iron Mountain

This Iron Mountain chart shows the valuation of its unique business, storing physical and digital data for thousands of companies. Revenue stability is ensured by long-term contracts. This metric reflects how investors value the company's predictability of cash flows and its successful transformation into digital asset and data center management.

Schedule P/E - Iron Mountain

P/E of the market segment - Investors specialized

Iron Mountain is a global leader in data and asset storage and management. The company provides physical document storage, digital data management, and information security services. This chart reflects the average valuation in the specialty REIT sector, providing insight into how investors value companies that manage critical data infrastructure.

Market Segment P/E Chart - Investors specialized

P/E of the market as a whole

Iron Mountain is a global leader in information storage and management, from physical archives to digital data in data centers. It's a business built on the need for security and long-term preservation. This chart shows the overall market situation. Comparisons help us understand whether Iron Mountain is viewed as a stable, almost utility-like service or a player in the growing data sector.

Overall Market P/E Chart

Future P/E of the company, segment and market as a whole

Future (projected) P/E of the company Iron Mountain

Iron Mountain is a global leader in storing and managing information and assets, from physical documents to data centers. This chart illustrates the market's expectations for the company's future cash flows. The valuation depends on the stability of its core storage business and the growth rate of its more modern data center segment, where the company is actively investing.

Chart of the company's future (projected) P/E Iron Mountain

Future (projected) P/E of the market segment - Investors specialized

Iron Mountain provides storage and information management services for both physical and digital data. This chart compares the company's future profitability expectations with those of specialized REITs. It assesses whether the market views their shift to data centers and digital services as a successful strategy for future revenue growth.

Future (projected) P/E graph of the market segment - Investors specialized

Future (projected) P/E of the market as a whole

Iron Mountain is a global leader in information storage and management, from paper archives to cloud data. This graph of overall market expectations is important because economic growth generates more documents and data requiring secure storage. For investors, the company represents a stable business, less susceptible to market volatility.

Chart of the future (projected) P/E of the market as a whole

Profit of the company, segment and market as a whole

Company profit Iron Mountain

Iron Mountain is a global leader in information storage and management. The company provides physical document storage services and digital data management in its data centers. Its revenue is generated through long-term contracts and consistent demand for secure storage. This chart reflects the stability and growth of its information management business.

Company profit chart Iron Mountain

Profit of companies in the market segment - Investors specialized

Iron Mountain is a global leader in storing and managing information and assets, from physical documents to cloud data. This chart shows the returns of specialized investors. Companies' need for secure data storage and regulatory compliance provides Iron Mountain with a stable and predictable business.

Profit chart of companies in the market segment - Investors specialized

Overall market profit

Iron Mountain is a global leader in storing and managing information, both physical and digital. The company's services are critical to businesses in any economic climate, ensuring data security. This creates a stable revenue stream that is less volatile than the overall corporate earnings trend shown in this chart.

Overall Market Profit Chart

Future (predicted) profit of the company, segment and market as a whole

Future (projected) profit of the company Iron Mountain

Iron Mountain is a global leader in storing and managing information, both physical and digital. This chart reflects revenue expectations based on stable demand for document storage services and a growing data center segment. The company's business generates predictable cash flow, making analysts' forecasts quite robust.

Graph of future (projected) profit of the company Iron Mountain

Future (predicted) profit of companies in the market segment - Investors specialized

Iron Mountain is a global leader in information storage and management, from physical archives to data centers. This chart shows the projected total return for the specialized REIT sector. It reflects overall trends in data management and the demand for secure storage, which is a fundamental factor in assessing the growth and profitability of Iron Mountain's assets.

Graph of future (predicted) profits of companies in a market segment - Investors specialized

Future (predicted) profit of the market as a whole

Iron Mountain is a global leader in data and asset storage and management. Its business is stable, but macroeconomic trends, as reflected here, are impacting its growth rate. Economic growth is increasing the volume of corporate data and documents being created that require storage. The shift to digitalization is also creating demand for its data center services.

Chart of future (predicted) profits of the market as a whole

P/S of the company, segment and market as a whole

P/S - Iron Mountain

Iron Mountain is a global leader in information storage and management, from physical archives to cloud data. Its business model is built on long-term contracts and stable payments. This chart illustrates how highly investors value this predictable revenue, which is generated by companies' constant need to securely store their data.

Schedule P/S - Iron Mountain

P/S market segment - Investors specialized

Iron Mountain is a global leader in information storage and management, from physical archives to digital data in data centers. It's a business built on trust and security. This chart shows the average revenue estimate for specialized companies, helping investors understand how the market values ​​Iron Mountain's unique and sustainable business model.

Market Segment P/S Chart - Investors specialized

P/S of the market as a whole

Iron Mountain is a global leader in information storage and management, from physical archives to data centers. The company is transforming into digital services while maintaining stable revenue from its traditional business. This chart helps assess how the market values ​​this hybrid model—a combination of a stable "old" business and a growing "new" one—against average market multiples.

Overall Market Price/Shares Chart

Future P/S of the company, segment and market as a whole

Future (projected) P/S of the company Iron Mountain

Iron Mountain is a global leader in storing and managing information, both physical and digital. The company's future revenue depends on the growing need for businesses to securely store data and archives. This chart shows how the market perceives the stability of this business and its growth potential through data center expansion.

The graph of the company's future (projected) P/S Iron Mountain

Future (projected) P/S of the market segment - Investors specialized

Iron Mountain is a global leader in storing and managing information, physical and digital assets. The company is transforming its business by aggressively expanding its data center business. This chart shows how investors assess its future revenue prospects, balancing the company's stable traditional business with growth potential in digital infrastructure.

Future (projected) P/S market segment graph - Investors specialized

Future (projected) P/S of the market as a whole

Iron Mountain is a leader in information storage and management. In the era of digitalization and data growth, their services are becoming critical. The overall market optimism reflected in the chart indicates business growth, which means growing volumes of data that need to be protected and analyzed. Iron Mountain provides the infrastructure for this growth, monetizing the information explosion.

Chart of the future (projected) P/S of the market as a whole

Sales of the company, segment and market as a whole

Company sales Iron Mountain

Iron Mountain is a global leader in information storage and management. The company generates revenue by providing physical document storage services, as well as digital data and data center management. This chart shows the total revenue from these services, reflecting the growing need for businesses to securely and efficiently manage their information assets.

Company sales chart Iron Mountain

Sales of companies in the market segment - Investors specialized

Iron Mountain is a global leader in information and asset storage and management. The company's business is diversified, ranging from physical document and data storage to digital archive management and data center services. Revenue is generated through long-term storage contracts. This graph reflects the stable demand for secure asset management, both physical and digital, making IRM's business resilient.

Sales chart of companies in the market segment - Investors specialized

Overall market sales

Iron Mountain is a global leader in information storage and management, from physical archives to cloud data. Demand for its services is stable, as companies are required to retain documents. However, the growth shown in this graph drives the creation of new data and documents, ensuring long-term utilization of Iron Mountain's storage facilities and data centers.

Market sales chart as a whole

Future sales volume of the company, segment and market as a whole

Future (projected) sales of the company Iron Mountain

Iron Mountain is a global leader in the storage and management of physical and digital data. The company makes its money by providing secure document storage and servers. This chart shows the projected growth in demand for information management services, including the shift to digital solutions, which forms the basis of this specialized REIT's future revenue.

Schedule of future (projected) sales of the company Iron Mountain

Future (projected) sales of companies in the market segment - Investors specialized

Iron Mountain is a global leader in information storage and management, including physical and digital archives. The data presented reflects general forecasts for the specialized REIT segment. Investors should consider how the company's transformation into data center management and digital services correlates with declining demand for paper document storage.

Schedule of future (projected) sales of companies in the market segment - Investors specialized

Future (projected) sales of the market as a whole

Iron Mountain, a global leader in information storage and management, sees this chart as a reflection of growing data volumes. The growth in overall business activity predicted by the chart means that companies are generating ever more documents and digital data that require secure storage and management. This ensures steady demand for Iron Mountain's services.

Schedule of future (predicted) sales of the market as a whole

Marginality of the company, segment and market as a whole

Company marginality Iron Mountain

Iron Mountain is a global leader in the storage and management of information, both physical and digital. Their business is built on long-term contracts with companies that trust them with their archives and data. This chart shows how their unique business model, combining real estate and services, generates stable and predictable net profits.

Company marginality chart Iron Mountain

Market segment marginality - Investors specialized

Iron Mountain is a global leader in information storage and management, physical archives, and data. This chart reflects the profitability of its services compared to other specialized REITs. The company's success is built on customer trust, the highest security standards, and the gradual transition to digital data management in its data centers.

Market segment marginality chart - Investors specialized

Market marginality as a whole

Iron Mountain is a leader in information storage and management, from physical archives to cloud data. Demand for its services is relatively stable, as companies are required to retain documents. However, overall economic activity, reflected in the graph, influences the rate of growth of new data volumes and customers' willingness to pay for more expensive digital services.

Market marginality chart for the overall market

Employees in the company, segment and market as a whole

Number of employees in the company Iron Mountain

Iron Mountain is a unique company providing storage for both physical archives and digital data. This chart illustrates the dual nature of its business. Stability or slow growth in the physical storage segment is offset by hiring specialists in digital transformation and data management, reflecting the company's strategic shift toward higher-margin services.

Chart of the number of employees in the company Iron Mountain

Share of the company's employees Iron Mountain within the market segment - Investors specialized

Iron Mountain is a global leader in information storage and management, from physical archives to digital data in data centers. This chart shows the company's share of the secure storage niche. This reflects its global scale and the trust of thousands of organizations that entrust it with their most valuable assets.

Graph of the company's share of employees Iron Mountain within the market segment - Investors specialized

Number of employees in the market segment - Investors specialized

Iron Mountain is a global leader in information storage and management, from physical archives to cloud data. This chart reflects employment trends in the specialized asset management services sector. The stable labor demand in this niche highlights the growing importance of secure data storage, which is the foundation of Iron Mountain's sustainable business.

Graph of the number of employees in the market segment - Investors specialized

Number of employees in the market as a whole

Iron Mountain provides storage and management services for physical and digital archives. Their clients include companies from all sectors of the economy. This total occupancy chart reflects the volume of business activity. Growing numbers of employees and companies lead to increased document flow and the volume of data that needs to be securely stored, which directly creates demand for Iron Mountain's services.

Chart of the number of employees in the market as a whole

Market capitalization per employee (in thousands of dollars) of the company, segment, and market as a whole

Market capitalization per employee (in thousands of dollars) of the company Iron Mountain (IRM)

Iron Mountain is a leader in storing and managing information, both physical and digital. This chart illustrates a business model built on trust and infrastructure. Its high cost per employee is explained by its ownership of vast, secure storage facilities and data centers, maintained by a relatively small staff.

Chart of market capitalization per employee (in thousands of dollars) of the company Iron Mountain (IRM)

Market capitalization per employee (in thousands of dollars) in the market segment - Investors specialized

Iron Mountain (IRM) is a REIT that started out in the "heavy" business of physical document storage. It is now actively transforming into a "light" business of digital data management and data centers. This chart shows the market value per employee in this hybrid model, balancing "old" and "new" assets.

Market capitalization per employee (in thousands of dollars) by market segment - Investors specialized

Market capitalization per employee (in thousands of dollars) for the overall market

Iron Mountain is a unique business providing physical archive storage and digital data management. Its value combines real estate and technology services. This chart reflects how the market values ​​each employee's ability to generate revenue from its extensive network of secure storage facilities, transforming trust and security into value.

Market capitalization per employee (in thousands of dollars) for the overall market

Profit per employee (in thousands of dollars) for the company, segment, and market as a whole

Profit per employee (in thousands of dollars) of the company Iron Mountain (IRM)

Iron Mountain specializes in storing and managing physical archives (documents) and data (data centers). It's a unique business that combines real estate and services. This chart shows how much revenue each employee generates maintaining these information "fortresses." It reflects the effectiveness of their model, which balances "unmanned" storage with data management services.

Company Profit Per Employee (in thousands of dollars) Chart Iron Mountain (IRM)

Profit per employee (in thousands of dollars) in the market segment - Investors specialized

Iron Mountain is a REIT that stores physical documents (archives) and provides data center services. This chart shows the benchmark for "specialized investors" (REITs). It's a "lightweight" model. A small staff manages a gigantic portfolio of secure warehouses, generating sticky rental income.

Chart of profit per employee (in thousands of dollars) in the market segment - Investors specialized

Profit per employee (in thousands of dollars) for the market as a whole

Iron Mountain is a global leader in information storage and management, from physical archives to cloud data. This business requires vast, yet well-protected and automated, facilities. This graph demonstrates a model where the primary revenue driver is storage infrastructure, not people, allowing a small team to generate stable and high cash flow.

Chart of profit per employee (in thousands of dollars) for the market as a whole

Sales to employees of the company, segment and market as a whole

Sales per company employee Iron Mountain (IRM)

Iron Mountain is a global leader in information storage and management, from physical archives to data centers. This chart reflects the effectiveness of its business model. Its high revenue per employee is driven by the management of vast infrastructure assets that require minimal staffing and generate stable revenue.

Sales chart per company employee Iron Mountain (IRM)

Sales per employee in the market segment - Investors specialized

Iron Mountain is a global leader in physical document and data storage (REIT). Their business is the ownership and maintenance of highly secure facilities. It's a capital-intensive business with a relatively small staff. This chart shows the industry average revenue per employee. It helps assess the effectiveness of their asset management model.

Sales per employee chart in the market segment - Investors specialized

Sales per employee for the market as a whole

Iron Mountain is a company that started out as a physical document storage company (archives) and is now a major data center operator. Their business is secure storage, whether of paper or data. It's a capital-intensive business. This graph shows how much revenue their team generates by managing these highly secure facilities.

Sales per employee chart for the market as a whole

Short shares by company, segment and market as a whole

Shares shorted by company Iron Mountain (IRM)

Iron Mountain, a company that started out as a physical document storage provider, is now transforming into a data center REIT. This chart reflects bets against the company. Bears may be shorting the stock, arguing that its "old" paper archive storage business is dying, while its new data center business requires massive capital investment in the face of fierce competition from giants.

Short Shares Chart for the Company Iron Mountain (IRM)

Shares shorted by market segment - Investors specialized

Iron Mountain (IRM), a company that started out as a physical document storage company, is now a major data center REIT. This chart shows the market's performance against the specialized REIT sector. The rising price could reflect concerns about the skyrocketing energy costs of data centers or slowing demand for cloud computing, which IRM depends on for growth.

Chart of the share of shares shorted by market segment - Investors specialized

Shares shorted by the overall market

Iron Mountain is a global leader in the storage and management of physical and digital data (REITs). They store everything from paper archives to server racks. Their business is based on long-term contracts and high levels of trust, which ensures stable income. When fear reigns in the market, as this chart reflects, investors seek "safe haven" assets. Iron Mountain's stable rental income makes it attractive.

Chart of the percentage of shares shorted across the market as a whole

RSI 14 indicator for a company, segment, and market as a whole

The company's RSI 14 indicator Iron Mountain (IRM)

Iron Mountain is a REIT whose core business is storing paper documents. The company is actively diversifying into data centers. This chart measures momentum. "Oversold" (below 30) is often caused by panic over rising interest rates (which hits all REITs) or fears that the paper business is dying. "Overbought" (above 70) reflects investor confidence in the success of the digital transformation and the stability of dividends.

RSI 14 indicator chart for the company's stock Iron Mountain (IRM)

RSI 14 Market Segment - Investors specialized

Iron Mountain (IRM) is a data "fortress." They store physical archives (paper) and lease out data center capacity (digital). RSI_14_Seg for "Investors Specialized" (REITs) shows the sector's "temperature." It helps us understand: is IRM's growth a reflection of their successful transition to digital or a general overheating of the data center sector?

RSI 14 indicator chart for stocks of companies in the market segment - Investors specialized

RSI 14 for the overall market

Iron Mountain is a unique REIT that began with physical document storage and is now actively building data centers. They store both physical and digital assets. This chart shows the overall market frenzy. IRM's business, based on long-term contracts, is much more stable than the overall market and can serve as a defensive asset during periods of panic (oversold conditions).

RSI 14 indicator chart for stocks of companies across the market as a whole

Analyst consensus forecast for the company's share price, the segment, and the market as a whole

Analyst consensus stock price forecast IRM (Iron Mountain)

Iron Mountain is a global leader in the storage and management of physical archives and data. The company is transforming itself by aggressively building data centers for the digital world. This chart shows how analysts assess the balance between the stable but stagnant "paper" business and the rapidly growing but capital-intensive data center segment.

A chart showing analyst consensus forecasts for the expected stock price. IRM (Iron Mountain)

The difference between the consensus estimate and the actual stock price IRM (Iron Mountain)

Iron Mountain is a REIT specializing in physical document and data storage that is actively transforming into a data center operator. This chart shows the difference between the consensus estimate and the price. It illustrates whether analysts believe this hybrid strategy (stable storage and growing data centers) will succeed.

A chart showing the difference between the consensus forecast and the actual stock price. IRM (Iron Mountain)

Analyst consensus forecast for stock prices by market segment - Investors specialized

Iron Mountain is a REIT that physically stores documents for corporations and is also expanding into the fast-growing data center storage business. This chart shows analysts' overall expectations for the specialized REIT sector. It reflects whether experts believe demand for storage (both physical and digital) will grow.

A chart showing analyst consensus price forecasts for stocks in a market segment. - Investors specialized

Analysts' consensus forecast for the overall market share price

Iron Mountain, a company that started out storing physical documents in former mines, is now a major data center operator. They store both physical and digital information. This chart shows the overall market sentiment. For IRM, it's important to understand how these expectations impact demand for their services—from archival storage to cloud computing. (346)

A chart showing analyst consensus forecasts for the overall market share price.

AKIMA index of the company, segment and market as a whole

AKiMA Company Index Iron Mountain

Iron Mountain is a unique REIT specializing in storage. Historically, they stored physical documents (archives) for businesses, but are now rapidly expanding into the data center segment. This chart reflects their transformation, weighing the stable but slow-growing returns of paper storage against the fast-growing and capital-intensive data center business.

AKIMA Index Chart for the Company Iron Mountain

AKIMA Market Segment Index - Investors specialized

Iron Mountain is a unique REIT; the company has historically dominated physical document storage for businesses and is now rapidly expanding into digital storage (data centers). This composite metric evaluates the REIT. The chart shows the sector average. This benchmark: how does IRM's hybrid (physical + digital) model differentiate it from the average REIT?

AKIMA Market Segment Index Chart - Investors specialized

The AKIM Index for the overall market

Iron Mountain is a unique REIT. Historically, the company has been storing physical documents for businesses, but is now rapidly growing in the digital data center segment. This chart, reflecting the market average, is important for context. It helps assess how IRM, which combines a stable legacy business with growth in data centers (and is sensitive to rates), compares to the overall macroeconomic picture.

AKIM Index chart for the overall market