The company's competitors:CNSNEANADNVGSIISTEWAAMINMZNBXGPTANRKWDIGGNPAXSNIENDMOIFNNXJNPFDNBBNMAISDHYHFROARDCBRWRFMZJGHNPCTFTFNUWNPVOPPNXGECFGLQIAFVFLIHDERHHNWHNNARGTGLVNMSJMMMXECOHNRCGTPZBSIGCBHINSINDPIHTAMIO

GURU.Markets stock price, segment price, and overall market index valuation

The company's share price Principal Real Estate

Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgages. Its share price is driven by the commercial real estate market, interest rate dynamics, and the creditworthiness of borrowers.

Company stock price chart Principal Real Estate

Share prices of companies in the market segment - Specialized fund management

Principal Real Estate is a closed-end mutual fund (CEF) that invests in a portfolio of real estate-related securities, including REIT shares and commercial mortgage bonds. We categorize it as "Specialized Fund Management." The chart below reflects the dynamics of the public real estate investment sector.

Stock price chart of companies in the market segment - Specialized fund management

Broad Market Index - GURU.Markets

Principal Real Estate Income Fund is a closed-end mutual fund that invests in a diversified portfolio of commercial real estate securities. We classify it as a "Specialized Fund Management" fund. The chart below shows how investors view the commercial real estate sector.

Broad Market Index Chart - GURU.Markets

Change in the price of a company, segment, and market as a whole per day

PGZ - Daily change in the company's share price Principal Real Estate

The Principal Real Estate Income Fund's daily performance reflects volatility in the commercial real estate and mortgage-backed securities markets. This indicator demonstrates sensitivity to interest rates and economic conditions, serving as a proxy for REIT investors.

Daily change chart of the company's share price Principal Real Estate

Daily change in the price of a set of shares in a market segment - Specialized fund management

The Principal Real Estate Income Fund's daily performance reflects volatility in the commercial real estate and mortgage-backed securities markets. This metric demonstrates sensitivity to interest rates and economic conditions, serving as a proxy for REIT investors.

Graph of daily price changes for a set of shares in a market segment - Specialized fund management

Daily change in the price of a broad market stock, index - GURU.Markets

The Principal Real Estate Income Fund is an investment fund that invests in real estate-related securities. Its share price is driven by the global real estate market and interest rates. Its performance reflects the health of this key economic sector and contributes to the overall investment market momentum.

Daily chart of changes in the price of broad market stocks, index - GURU.Markets

Dynamics of market capitalization of the company, segment and the market as a whole over 12 months

Annual dynamics of the company's market capitalization Principal Real Estate

The Principal Real Estate Income Fund's year-over-year performance reflects the state of the commercial real estate market. The fund's 12-month market cap change reflects how investors value its diversified portfolio of mortgage-backed securities and REITs, making it sensitive to interest rates and the health of the economy.

Chart of the annual dynamics of the company's market capitalization Principal Real Estate

Annual dynamics of market capitalization of the market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund (CEF) that invests in a diversified portfolio of real estate debt and equity instruments. Its performance is determined not by its operating performance, but by its investment results. The chart will show the effectiveness of its management strategy.

Graph of annual dynamics of market capitalization of a market segment - Specialized fund management

Annual dynamics of market capitalization of broad market stocks, index - GURU.Markets

The ticker PGZ belongs to the closed-end mutual fund (CEF) Principal, not to the operating company. Analysis of its performance in the context of the business is impossible. The performance of such funds depends on the value of their portfolio (in this case, real estate stocks) and can trade at a significant discount to that value.

Chart of the annual dynamics of the market capitalization of broad market stocks, index - GURU.Markets

Dynamics of market capitalization of the company, segment and the market as a whole for the month

Monthly dynamics of the company's market capitalization Principal Real Estate

Principal Real Estate is a closed-end fund (CEF) that invests in real estate stocks. Its monthly performance reflects the global real estate market and interest rate movements. Its NAV and the discount/premium to it are key factors.

Chart of monthly dynamics of the company's market capitalization Principal Real Estate

Monthly dynamics of market capitalization of the market segment - Specialized fund management

The Principal Real Estate Income Fund is a closed-end fund (CEF) that invests in commercial mortgage-backed securities (CMBS) and other real estate-related debt instruments. Its returns are sensitive to the commercial real estate market. The chart for the specialized REITs and CMBS sector reflects these risks and opportunities.

Chart of monthly dynamics of market capitalization of a market segment - Specialized fund management

Monthly dynamics of market capitalization of broad market stocks, index - GURU.Markets

The Principal Real Estate Income Fund invests in commercial real estate through equities and debt instruments. Its performance reflects the global real estate market and is sensitive to interest rate changes. The fund offers exposure to real assets and may perform differently than the stock market alone.

Chart of monthly dynamics of market capitalization of broad market stocks, index - GURU.Markets

Dynamics of market capitalization of the company, segment and the market as a whole for the week

Weekly dynamics of the company's market capitalization Principal Real Estate

Principal Real Estate Income Fund, a closed-end mutual fund that invests in real estate-related debt and equity instruments, whose weekly share price performance mirrors the state of the real estate market. Changes in interest rates and investor sentiment in the sector drive short-term share price fluctuations.

Chart of the weekly dynamics of the company's market capitalization Principal Real Estate

Weekly dynamics of market capitalization of the market segment - Specialized fund management

Principal Real Estate is a closed-end mutual fund investing in real estate-related securities. The chart shows how its weekly performance compares to the real estate market, reflecting the managers' skill in asset selection in the current interest rate environment.

Weekly market capitalization dynamics chart for a market segment - Specialized fund management

Weekly dynamics of market capitalization of stocks of the broad market, index - GURU.Markets

Principal Real Estate is a real estate investment trust. Its returns depend on the state of the real estate market. The chart shows how its performance compares to the market, reflecting both the stability of the REIT and the cyclical nature of the real estate market.

Weekly market capitalization chart of broad market stocks, index - GURU.Markets

Market capitalization of the company, segment and market as a whole

PGZ - Market capitalization of the company Principal Real Estate

The Principal Real Estate Income Fund chart is a financial portfolio investing in real estate debt. Its capitalization reflects the demand for income-producing instruments backed by commercial real estate. Its price dynamics and premium/discount to NAV are a barometer of market health and investor appetite for credit risk.

Company market capitalization chart Principal Real Estate

PGZ - Share of the company's market capitalization Principal Real Estate within the market segment - Specialized fund management

Principal Real Estate's market share in the fund management sector reflects its focus on commercial real estate investments through mortgage-backed securities. Its market weight reflects investor confidence in its ability to generate income while managing real estate market risks.

Company Market Capitalization Share Chart Principal Real Estate within the market segment - Specialized fund management

Market capitalization of the market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund investing in commercial real estate. The chart below is not sector-specific. Its performance reflects the state of the commercial real estate market, particularly in an environment of high rents and low office occupancy.

Market segment market capitalization chart - Specialized fund management

Market capitalization of all companies included in a broad market index - GURU.Markets

Principal Real Estate is a closed-end mutual fund that invests in real estate-related securities. Its capitalization reflects the value of its portfolio and its investment strategy. The chart below shows the economic weight of such publicly traded funds.

A chart of the market capitalization of all companies included in the broad market index. - GURU.Markets

Book value capitalization of the company, segment and market as a whole

PGZ - Book value capitalization of the company Principal Real Estate

Principal Real Estate is a closed-end fund. Its book value (NAV) is the net asset value of its assets. The chart below shows how the valuation of its real estate portfolio has changed. This reflects the market, not the company's operating performance.

Company balance sheet capitalization chart Principal Real Estate

PGZ - Share of the company's book capitalization Principal Real Estate within the market segment - Specialized fund management

Principal Real Estate is a closed-end fund. Its assets are financial instruments, not factories or real estate. The percentage of tangible assets will tend toward zero, reflecting its nature as a purely financial entity.

Chart of the company's book capitalization share Principal Real Estate within the market segment - Specialized fund management

Market segment balance sheet capitalization - Specialized fund management

The Principal Real Estate Income Fund is a financial instrument. Its balance reflects the value of real estate-related securities. The chart will show the minimum share, as the fund's tangible assets are limited to the management company's office infrastructure.

Market segment balance sheet capitalization chart - Specialized fund management

Book value of all companies included in the broad market index - GURU.Markets

The Principal Real Estate Income Fund balance sheet is a diversified portfolio of commercial real estate and mortgage-backed securities. The fund's assets are interests in real estate and mortgages, aimed at generating stable income for investors in the real estate sector.

Chart of book value of all companies included in the broad market index - GURU.Markets

The ratio of market capitalization to book capitalization of a company, segment, and the market as a whole

Market capitalization to book capitalization ratio - Principal Real Estate

Principal Real Estate (PGZ) is a closed-end mutual fund (CEF) that invests in global real estate stocks. Its market price can differ from its net asset value (NAV). This chart shows how investor sentiment toward commercial real estate around the world influences this difference.

Market to Book Capitalization Ratio Chart - Principal Real Estate

Market to book capitalization ratio in a market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund (CEF) that invests in debt instruments backed by commercial real estate. The chart shows the ratio of its market price to net asset value (NAV), reflecting investor sentiment regarding the commercial real estate market.

Market to book capitalization ratio chart for a market segment - Specialized fund management

Market to book capitalization ratio for the market as a whole

Principal Real Estate Income Fund is a closed-end fund investing in commercial mortgage-backed securities. The chart shows how the market values ​​its portfolio. Its market price can trade at a premium or discount to net asset value (NAV), depending on investor sentiment regarding the commercial real estate market and interest rates.

Market to book capitalization ratio chart for the overall market

Debts of the company, segment and market as a whole

PGZ - Company debts Principal Real Estate

Principal Real Estate Income Fund is a closed-end fund investing in commercial real estate. The use of debt financing (leverage) is part of its strategy to potentially increase shareholder returns. This chart shows the extent of this leverage.

Company debt schedule Principal Real Estate

Market segment debts - Specialized fund management

Principal Real Estate Income Fund is a closed-end mutual fund that invests in commercial mortgages and real estate-related securities. Like other similar funds, it uses leverage. This chart is less relevant, as debt is an investment tool used to enhance portfolio returns, not an operating component.

Market segment debt schedule - Specialized fund management

Market debt in general

Market debt chart as a whole

Debt to book value of the company, segment and market as a whole

The company's debt to book capitalization ratio Principal Real Estate

Principal Real Estate is a closed-end mutual fund specializing in real estate. Like many funds, it can use leverage to increase its portfolio and potential returns. This chart directly shows the level of leverage, allowing investors to assess both the upside potential and the risks.

A graph of a company's debt to book value Principal Real Estate

Market segment debt to market segment book capitalization - Specialized fund management

Real estate fund management, like Principal Real Estate, is a business built on sector expertise and capital raising. This chart illustrates the overall debt position in the asset management sector. It allows one to assess how the financial model of this fund, part of a large financial group, differs from that of independent managers and REITs.

Market segment debt to market segment book value graph - Specialized fund management

Debt to book value of all companies in the market

Principal Real Estate is a closed-end fund that invests in real estate. Real estate investments are traditionally associated with high levels of leverage. The chart clearly demonstrates how their leveraged model compares to other sectors of the economy.

Debt to book value chart of all companies in the market

P/E of the company, segment and market as a whole

P/E - Principal Real Estate

This metric for the Principal Real Estate Income Fund, a closed-end mutual fund, should be analyzed differently than for stocks. It reflects the ratio of the share's market price to the net asset value of its assets (commercial real estate and securities). The dynamics reflect investor demand for this asset class.

Schedule P/E - Principal Real Estate

P/E of the market segment - Specialized fund management

This metric for the Principal Real Estate Income Fund, a closed-end mutual fund, has no direct industry equivalent. The chart shows the average valuation for a broad class of similar funds. It helps understand whether a given fund is trading at a premium or discount to the average valuation for the real estate asset class.

Market Segment P/E Chart - Specialized fund management

P/E of the market as a whole

The Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgage-backed securities and other real estate-backed debt instruments. Its goal is high current income. This chart reflects the state of the real estate market. It helps understand how commercial real estate credit risk and interest rate changes affect the performance and valuation of this specialized fund.

Overall Market P/E Chart

Future P/E of the company, segment and market as a whole

Future (projected) P/E of the company Principal Real Estate

Principal Real Estate Income Fund is a closed-end mutual fund that invests in commercial mortgage-backed securities and other real estate-related debt instruments. Its future returns are dependent on the commercial real estate market and interest rates. This chart shows how the market evaluates the quality of its portfolio and its ability to generate income.

Chart of the company's future (projected) P/E Principal Real Estate

Future (projected) P/E of the market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end mutual fund that invests in commercial mortgages and other real estate-related securities for income. The chart shows sector expectations, providing context for comparing this fund to other real estate investments.

Future (projected) P/E graph of the market segment - Specialized fund management

Future (projected) P/E of the market as a whole

Principal Real Estate Income Fund is a closed-end mutual fund that invests in commercial mortgage-backed securities and other real estate-related debt instruments. This broad market expectations chart provides a general backdrop. Investor optimism supports stability in the real estate market, reducing risks to the fund's portfolio assets.

Chart of the future (projected) P/E of the market as a whole

Profit of the company, segment and market as a whole

Company profit Principal Real Estate

Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgage-backed securities (CMBS). This chart reflects the performance of its investment strategy. Investor returns are reflected in net asset value (NAV) growth and high dividends generated by the portfolio.

Company profit chart Principal Real Estate

Profit of companies in the market segment - Specialized fund management

Propanc Biopharma Inc. is a biotech company developing enzyme-based therapies for cancer treatment. This approach is unconventional. This graph reflects the state of the industry, where innovative but risky scientific ideas require years of research, and most such companies fail to reach profitability, remaining in clinical trials.

Profit chart of companies in the market segment - Specialized fund management

Overall market profit

Principal Real Estate Income Fund (ticker PGZ) is a closed-end fund that invests in commercial real estate securities. Its returns and share price are influenced by the real estate market, rental rates, and interest rate policy. This chart provides insight into the overall economic environment affecting the sector.

Overall Market Profit Chart

Future (predicted) profit of the company, segment and market as a whole

Future (projected) profit of the company Principal Real Estate

Principal Real Estate Income Fund is a closed-end mutual fund (CEF) that invests in commercial mortgage-backed securities (CMBS) and other real estate-related debt instruments. Its distribution forecast is based on the state of the commercial real estate and credit markets. This chart reflects analyst expectations for the sector.

Graph of future (projected) profit of the company Principal Real Estate

Future (predicted) profit of companies in the market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgage-backed securities (CMBS) and other real estate-related debt instruments. This chart shows the return projections for the real estate sector. It reflects the success of the fund's strategy in finding yield in the real estate-backed debt market.

Graph of future (predicted) profits of companies in a market segment - Specialized fund management

Future (predicted) profit of the market as a whole

The Principal Real Estate Income Fund is a closed-end investment fund that invests in commercial real estate and mortgage-backed securities. Its performance is directly linked to the state of the real estate market. This corporate earnings expectations chart reflects the overall economic health, which is a key factor for this sector.

Chart of future (predicted) profits of the market as a whole

P/S of the company, segment and market as a whole

P/S - Principal Real Estate

Principal Real Estate Income Fund is a closed-end mutual fund that invests in commercial mortgage-backed securities (CMBS) and other real estate. Its rating reflects investors' opinions on the quality of its portfolio and its ability to generate income in the current commercial real estate market.

Schedule P/S - Principal Real Estate

P/S market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgage-backed securities (CMBS) and other real estate-backed debt instruments. Its goal is to provide high current income. This chart shows the average valuation in the sector, allowing you to assess how the market views the fund's investment strategy and performance.

Market Segment P/S Chart - Specialized fund management

P/S of the market as a whole

Principal Real Estate Income Fund is a closed-end investment fund that invests in commercial mortgage-backed securities. Its goal is to provide high current income. This chart illustrates the market-wide revenue valuation, providing a benchmark for comparing the fund's income-focused valuation to real-world companies.

Overall Market Price/Shares Chart

Future P/S of the company, segment and market as a whole

Future (projected) P/S of the company Principal Real Estate

Principal Real Estate Income Fund is a closed-end investment fund that invests in commercial mortgage-backed securities. This chart shows how investors perceive the fund's future interest income. Its performance depends on the state of the commercial real estate market and the quality of the securities in the fund's portfolio.

The graph of the company's future (projected) P/S Principal Real Estate

Future (projected) P/S of the market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgage-backed securities (CMBS) and other real estate-related debt instruments. The chart shows how the market perceives the fund's future returns, which is influenced by the state of the commercial real estate market and credit spreads.

Future (projected) P/S market segment graph - Specialized fund management

Future (projected) P/S of the market as a whole

Investor sentiment regarding future revenue depends on the state of the real estate market. Principal Real Estate Income Fund is a closed-end fund that invests in commercial real estate through securities. Its performance reflects how professional investors assess the prospects of office buildings, warehouses, and shopping centers, which is an important indicator for the overall economy.

Chart of the future (projected) P/S of the market as a whole

Sales of the company, segment and market as a whole

Company sales Principal Real Estate

Principal Real Estate is a closed-end mutual fund that invests in commercial real estate and mortgage-backed securities. Its revenue consists of investment income: rental payments, interest, and capital gains from its portfolio. This chart reflects the results of its real estate investment strategy.

Company sales chart Principal Real Estate

Sales of companies in the market segment - Specialized fund management

The Principal Real Estate Income Fund is an exchange-traded fund (CEF) that invests in commercial mortgage-backed securities (CMBS) and other real estate-related debt instruments. This chart shows the performance of these specialized funds. It reflects the state of the commercial real estate market and investor appetite for income from asset-backed debt.

Sales chart of companies in the market segment - Specialized fund management

Overall market sales

Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgage-backed securities (CMBS). Its returns and risks are directly linked to the health of the US commercial real estate market. This chart of overall business activity is a barometer of the market's health, including office occupancy levels and retail activity.

Market sales chart as a whole

Future sales volume of the company, segment and market as a whole

Future (projected) sales of the company Principal Real Estate

Principal Real Estate Income Fund is a closed-end investment fund specializing in commercial real estate securities, including REIT shares and mortgage-backed securities. Its revenue is investment income. The forecast chart reflects analyst expectations for the commercial real estate market.

Schedule of future (projected) sales of the company Principal Real Estate

Future (projected) sales of companies in the market segment - Specialized fund management

Principal Real Estate (PGZ Fund) is a closed-end fund investing in commercial mortgage-backed securities (CMBS). Its returns are dependent on the commercial real estate market and interest rates. This chart shows projected returns for the entire fund management sector, reflecting analysts' overall expectations for the structured financial products market.

Schedule of future (projected) sales of companies in the market segment - Specialized fund management

Future (projected) sales of the market as a whole

The Principal Real Estate Income Fund is a closed-end fund that invests in commercial mortgage-backed securities and other real estate-backed debt instruments. Its returns are driven by the state of the commercial real estate market. This overall business activity chart is a key indicator of the health of this market, influencing the value of the fund's assets.

Schedule of future (predicted) sales of the market as a whole

Marginality of the company, segment and market as a whole

Company marginality Principal Real Estate

Principal Real Estate Income Fund is a closed-end mutual fund. This metric reflects the performance of its investment strategy. It shows what portion of the fund's income from its commercial real estate and mortgage-backed securities portfolio is converted into net profit for its shareholders.

Company marginality chart Principal Real Estate

Market segment marginality - Specialized fund management

Principal Real Estate Income Fund is a closed-end mutual fund investing in commercial real estate and mortgage-backed securities. Its performance reflects the effectiveness of its real estate portfolio. This chart provides an indirect assessment of the fund's operating structure compared to other real estate funds.

Market segment marginality chart - Specialized fund management

Market marginality as a whole

Principal Real Estate Income Fund is a closed-end investment fund that invests in commercial mortgage-backed securities (CMBS). Its goal is to provide high current income. Its performance is dependent on the commercial real estate market and interest rates. This total return chart is an indicator of the health of tenants and borrowers in this sector.

Market marginality chart for the overall market

Employees in the company, segment and market as a whole

Number of employees in the company Principal Real Estate

Principal Real Estate Income Fund is a closed-end mutual fund specializing in commercial real estate. It is managed by Principal. This chart shows that the fund itself has no direct employees. All real estate and securities portfolio management activities are handled by the management company's team of professionals.

Chart of the number of employees in the company Principal Real Estate

Share of the company's employees Principal Real Estate within the market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund investing in commercial mortgage-backed securities. This metric reflects the fund's compact management team. It demonstrates how Principal's small team of professionals manages a diversified portfolio to generate shareholder returns.

Graph of the company's share of employees Principal Real Estate within the market segment - Specialized fund management

Number of employees in the market segment - Specialized fund management

Principal Real Estate Income Fund is a closed-end fund investing in commercial mortgage-backed securities and other real estate-related debt instruments. This chart shows the overall employment in the fund management sector. It illustrates how the fund aims to provide investors with high current income from investments in the commercial real estate market.

Graph of the number of employees in the market segment - Specialized fund management

Number of employees in the market as a whole

Principal Real Estate Income Fund is a closed-end investment fund specializing in commercial real estate and mortgage-backed securities. Its goal is to generate stable income for investors. This overall employment profile is closely tied to the real estate sector. By investing in commercial properties, these funds support a market that employs millions of people, from builders to realtors.

Chart of the number of employees in the market as a whole

Market capitalization per employee (in thousands of dollars) of the company, segment, and market as a whole

Market capitalization per employee (in thousands of dollars) of the company Principal Real Estate (PGZ)

Principal Real Estate Income Fund is a closed-end investment fund specializing in real estate. This chart illustrates the financial management model. An extremely high capitalization per employee is the norm, as the fund's value is determined by the size of assets under management, not the number of people managing them.

Chart of market capitalization per employee (in thousands of dollars) of the company Principal Real Estate (PGZ)

Market capitalization per employee (in thousands of dollars) in the market segment - Specialized fund management

Principal Real Estate is a closed-end investment fund specializing in real estate. Its value is the value of the portfolio of assets under management. This metric reflects the performance of a small management team. A high value indicates that they successfully manage large amounts of real estate capital, and the market trusts their expertise and strategy.

Market capitalization per employee (in thousands of dollars) by market segment - Specialized fund management

Market capitalization per employee (in thousands of dollars) for the overall market

Principal Real Estate Income Fund is a closed-end investment fund (CEF) that invests in commercial real estate and mortgage-backed securities. It has no operating staff, only a management team. Its high capitalization per employee reflects the volume of assets under management, not operational performance.

Market capitalization per employee (in thousands of dollars) for the overall market

Profit per employee (in thousands of dollars) for the company, segment, and market as a whole

Profit per employee (in thousands of dollars) of the company Principal Real Estate (PGZ)

Principal Real Estate Income Fund (PGZ) is a closed-end mutual fund (CEF) rather than an operating company. It is a portfolio of real estate securities (REITs, CMBS) managed by Principal. The fund has no employees. This chart illustrates the asset management model, showing the fund's profitability on (nearly zero) employees.

Company Profit Per Employee (in thousands of dollars) Chart Principal Real Estate (PGZ)

Profit per employee (in thousands of dollars) in the market segment - Specialized fund management

Principal Real Estate (PGZ) is a closed-end investment fund specializing in real estate stocks. For asset managers, this metric reflects how efficiently the fund's team generates income relative to its operating expenses. The chart shows how PGZ compares to the sector average for employee profitability.

Chart of profit per employee (in thousands of dollars) in the market segment - Specialized fund management

Profit per employee (in thousands of dollars) for the market as a whole

Principal Real Estate (PGZ) (likely PGZ - Principal Real Estate Income Fund) is a closed-end fund (CEF) that invests in real estate securities (REITs, CMBS). Their business is asset management. This chart should show very high returns per employee, as a small team of managers manages a large portfolio.

Chart of profit per employee (in thousands of dollars) for the market as a whole

Sales to employees of the company, segment and market as a whole

Sales per company employee Principal Real Estate (PGZ)

For Principal Real Estate, a closed-end mutual fund, this chart shows the performance of its real estate strategy. Revenue per employee reflects the income generated by a portfolio of commercial real estate and mortgage-backed securities managed by a small team.

Sales chart per company employee Principal Real Estate (PGZ)

Sales per employee in the market segment - Specialized fund management

Principal Real Estate (PGZ) is a CEF investing in commercial real estate and mortgage-backed securities. This metric reflects the average revenue per employee for the segment. For the fund, this shows how efficiently Principal generates revenue per employee compared to other asset management firms.

Sales per employee chart in the market segment - Specialized fund management

Sales per employee for the market as a whole

Principal Real Estate (PGZ) is an exchange-traded fund (CEF), not an operating company. It is managed by an external company (Principal). Therefore, PGZ itself has no employees, and this metric is not applicable in the traditional sense. The fund's income comes from dividends and capital gains from its real estate portfolio, not operating revenue.

Sales per employee chart for the market as a whole

Short shares by company, segment and market as a whole

Shares shorted by company Principal Real Estate (PGZ)

Principal Real Estate (PGZ) is a closed-end mutual fund (CEF) that invests in REITs and other real estate. This chart shows how many investors are betting that the commercial real estate sector will continue to decline or that the fund's premium to its net asset value (NAV) will shrink.

Short Shares Chart for the Company Principal Real Estate (PGZ)

Shares shorted by market segment - Specialized fund management

Principal Real Estate (PGZ) is a closed-end mutual fund (CEF) that invests in real estate securities. This chart shows the aggregate short interest in the closed-end fund sector. It likely reflects bearish bets on the real estate market or arbitrage bets related to the fund's discount to asset value.

Chart of the share of shares shorted by market segment - Specialized fund management

Shares shorted by the overall market

Real estate funds like Principal Real Estate are particularly vulnerable when market pessimism increases. This chart demonstrates precisely this general bearish sentiment. If fear stems from rising rates, it hurts commercial real estate valuations and the ability to refinance debt, which directly impacts the fund's assets.

Chart of the percentage of shares shorted across the market as a whole

RSI 14 indicator for a company, segment, and market as a whole

The company's RSI 14 indicator Principal Real Estate (PGZ)

This chart measures investor appetite for the Principal Real Estate fund. As a closed-end fund (CEF), its price can deviate significantly from the net asset value (NAV). When the market is optimistic about commercial real estate or seeking yield, investors actively buy, pushing the oscillator into "overbought" territory, often above the NAV. Concerns about vacancy or rates trigger the opposite reaction.

RSI 14 indicator chart for the company's stock Principal Real Estate (PGZ)

RSI 14 Market Segment - Specialized fund management

Principal Real Estate (PGZ) is a closed-end fund (CEF), a "basket" of *REIT* stocks. Its performance depends on the portfolio and (more importantly) the *demand* for the fund itself (discount/premium to NAV). RSI_14_Seg for "Specialized fund management" (funds) shows the "temperature" of the *entire* sector. It helps us understand: is PGZ's rise a reflection of REIT hype or general overheating?

RSI 14 indicator chart for stocks of companies in the market segment - Specialized fund management

RSI 14 for the overall market

PGZ is a closed-end fund (CEF) that invests in real estate. This chart directly reflects its performance. During periods of market euphoria, the value of its assets (portfolio) rises. During periods of market panic, the value of these assets falls, which directly impacts the fund's valuation and its ability to pay dividends.

RSI 14 indicator chart for stocks of companies across the market as a whole

Analyst consensus forecast for the company's share price, the segment, and the market as a whole

Analyst consensus stock price forecast PGZ (Principal Real Estate)

Principal Real Estate Income Fund (PGZ) is a closed-end fund (CEF) that invests in commercial real estate-backed debt securities (CMBS, RMBS). This chart shows the average price target from analysts, reflecting their view of the fund's net asset value (NAV) and risks in the CRE sector.

A chart showing analyst consensus forecasts for the expected stock price. PGZ (Principal Real Estate)

The difference between the consensus estimate and the actual stock price PGZ (Principal Real Estate)

Principal Real Estate (PGZ) is a closed-end fund (CEF) that invests in REITs and other real estate. This chart shows the difference between the fund's market price and its "true" value. It measures the gap between the price and the consensus target, reflecting whether analysts see potential in the portfolio or believe it is trading at a discount to NAV.

A chart showing the difference between the consensus forecast and the actual stock price. PGZ (Principal Real Estate)

Analyst consensus forecast for stock prices by market segment - Specialized fund management

Principal Real Estate Income Fund (PGZ) is a closed-end fund (CEF) that invests in commercial real estate-backed debt obligations (CMBS). This chart shows general expectations for the specialized fund sector. It reflects whether experts believe the commercial mortgage market is stable or whether they expect defaults.

A chart showing analyst consensus price forecasts for stocks in a market segment. - Specialized fund management

Analysts' consensus forecast for the overall market share price

Principal Real Estate Income Fund (PGZ) is a closed-end mutual fund (CEF) that invests in a diversified portfolio of real estate securities (REITs, CMBS). This chart shows overall market sentiment. For a fund whose value is the value of its assets (real estate), overall optimism is important, but even more important is the interest rate environment, which has a significant impact on REITs.

A chart showing analyst consensus forecasts for the overall market share price.

AKIMA index of the company, segment and market as a whole

AKiMA Company Index Principal Real Estate

Principal Real Estate (PGZ) is a closed-end fund (CEF) that invests in a global portfolio of publicly traded real estate investment trusts (REITs) and other CRE-related income instruments. This chart is a summary indicator of its valuation. It reflects not only the net asset value (NAV) of the funds it holds, but also investor sentiment (discount/premium to NAV) and rate expectations.

AKIMA Index Chart for the Company Principal Real Estate

AKIMA Market Segment Index - Specialized fund management

Principal Real Estate (PGZ) is, as its name suggests, a fund or company managing a diversified real estate portfolio, likely a closed-end fund (CEF), like other Principal funds. The chart shows the average index for the segment, helping investors assess how successfully the managers of this real estate portfolio are executing their strategy compared to the sector average.

AKIMA Market Segment Index Chart - Specialized fund management

The AKIM Index for the overall market

Principal Real Estate Income Fund (PGZ) is a closed-end fund (CEF) investing in commercial mortgage-backed securities (CMBS) and REITs. This chart, which reflects the market average, provides a macro backdrop. It helps assess how this instrument, sensitive to the real estate market and rates, compares to the overall macroeconomic situation.

AKIM Index chart for the overall market