The company's competitors:PMBTIMOBUDDEOSTZBF-ATAPSAMRLXTPBUVVTLRYSNDLEPSMOGIMAPSISPRBLNEIXHLWVVIYHCXXIIKAVLIBGCASKPAPAEASTLFLYLQRNAPAVINEVWEVAPEAGCC

GURU.Markets stock price, segment price, and overall market index valuation

The company's share price MGP Ingredients, Inc.

MGP Ingredients is a diversified company, a leading producer of distilled spirits (for other brands) and food ingredients. Its share price reflects both the stability of this business and the growth of its own premium spirits brands.

Share prices of companies in the market segment - Narco food

MGP Ingredients produces distilled spirits (whiskey, gin) for other brands and also specializes in plant proteins and starches. We classify it in the "Alcohol and Food" segment due to its business diversification. The chart below shows how this stable yet competitive consumer sector is faring.

Broad Market Index - GURU.Markets

MGP Ingredients is a leading producer of distilled spirits (whiskey, gin) and specialty wheat proteins and starches. Its unique business makes it a component of the GURU.Markets index. The chart below compares its performance to the overall stock market.

Change in the price of a company, segment, and market as a whole per day

MGPI - Daily change in the company's share price MGP Ingredients, Inc.

Daily fluctuations at MGP, a producer of alcoholic beverages and food ingredients, reflect the stability of consumer demand. change_co measures sensitivity to grain prices and alcohol market trends. This metric is important for analyzing non-cyclical companies on System.GURU.Markets.

Daily change in the price of a set of shares in a market segment - Narco food

MGP Ingredients, Inc. is a producer of distilled spirits and food ingredients. This chart shows the average daily volatility of the sector. Comparing it to MGPI, a key supplier to many whiskey brands, helps to appreciate its unique position.

Daily change in the price of a broad market stock, index - GURU.Markets

MGP is a diversified producer, spanning from industrial spirits to craft spirits. Its business has both stable and cyclical components. The chart below shows overall market volatility, which is interesting to compare with MGP's approach.

Dynamics of market capitalization of the company, segment and the market as a whole over 12 months

Annual dynamics of the company's market capitalization MGP Ingredients, Inc.

MGP is a diversified producer, a leader in the production of alcoholic beverages and food ingredients. Its annual growth reflects both consumer trends in the alcohol market and the stable demand for its industrial products.

Annual dynamics of market capitalization of the market segment - Narco food

MGP Ingredients, Inc. is a leading producer of distilled spirits and specialty wheat proteins. Its business supplies many well-known alcohol brands. The chart shows how its unique position behind the scenes and the stable demand for its products influence its growth.

Annual dynamics of market capitalization of broad market stocks, index - GURU.Markets

MGP, as a producer of alcoholic beverages and food ingredients, is a classic example of a defensive sector. Demand for its products is stable throughout the economic cycle. The company's stock price is typically less volatile than the market, attracting investors seeking stability.

Dynamics of market capitalization of the company, segment and the market as a whole for the month

Monthly dynamics of the company's market capitalization MGP Ingredients, Inc.

The market capitalization of MGP, a diversified spirits producer, reflects two business cycles. The monthly fluctuations on the chart reflect the balance between its contract production of spirits for other brands and the growth of its own premium brands, such as Lux Row Distillers.

Monthly dynamics of market capitalization of the market segment - Narco food

This chart reflects the dynamics of the alcoholic beverage sector. For MGP, a diversified producer, it provides context. Its movements reflect both the stable demand for its products from craft brands and consumer trends for its private labels.

Monthly dynamics of market capitalization of broad market stocks, index - GURU.Markets

MGP Ingredients is a diversified producer, a leading supplier of distilled spirits (for whiskey and vodka), and also produces branded alcoholic beverages and food ingredients. A full-market chart helps assess how MGPI shares, as a stable consumer sector player, perform as a defensive asset.

Dynamics of market capitalization of the company, segment and the market as a whole for the week

Weekly dynamics of the company's market capitalization MGP Ingredients, Inc.

MGP Ingredients, a producer of distilled spirits and food ingredients, is showing mixed performance. Weekly share price fluctuations reflect both demand for craft spirits and trends in the plant-based protein market.

Weekly dynamics of market capitalization of the market segment - Narco food

MGP Ingredients, like other spirits producers, is dependent on overall consumer trends. Demand for craft spirits and premium brands is a general trend across the sector. The chart shows how MGPI's unique B2B model (supplying spirits to other brands) impacts its performance compared to consumer-focused companies.

Weekly dynamics of market capitalization of stocks of the broad market, index - GURU.Markets

MGP Ingredients, as a food and beverage producer, is often considered a defensive stock, less volatile than the overall market. Demand for its products is stable, which can smooth out share price fluctuations. The chart below allows you to compare MGPI's performance with the market and assess its defensive qualities.

Market capitalization of the company, segment and market as a whole

MGPI - Market capitalization of the company MGP Ingredients, Inc.

MGP Ingredients's chart represents a unique combination of spirits and food ingredients. The company's market capitalization reflects both the stable demand for industrial spirits for its whiskey and vodka brands and growth in the plant-based protein segment. Its dynamics reflect the market's appreciation of this diversified and sustainable business model.

MGPI - Share of the company's market capitalization MGP Ingredients, Inc. within the market segment - Narco food

MGP Ingredients is a unique company, a leading producer of distilled spirits (whiskey, gin) for other brands, as well as food ingredients. Its market capitalization reflects its dominance in this niche. The chart below shows the stability of its business, supported by the growth of craft beverages.

Market capitalization of the market segment - Narco food

MGP Ingredients is a leading producer of distilled spirits (whiskey, gin) and specialty wheat proteins. The chart below shows the market capitalization of the food sector. This valuation of the industry forms the basis for many well-known alcoholic beverage brands and food products.

Market capitalization of all companies included in a broad market index - GURU.Markets

MGP Ingredients is a unique company, a leading producer of distilled spirits (whiskey, gin) for other brands, as well as food ingredients. Its market capitalization reflects its hidden yet pivotal role in the beverage and food industry. Its economic share represents the weight of the business, which is the "secret sauce" behind the success of many well-known brands.

Book value capitalization of the company, segment and market as a whole

MGPI - Book value capitalization of the company MGP Ingredients, Inc.

MGP Ingredients is built on a unique combination of assets. The company's book value reflects its major distilleries producing whiskey and gin for other brands, as well as its food ingredient businesses, such as plant-based protein. The chart below shows how this diversified producer manages its industrial foundation.

MGPI - Share of the company's book capitalization MGP Ingredients, Inc. within the market segment - Narco food

MGP Ingredients owns large distilleries and food ingredient production facilities. These industrial complexes are its main material assets. The S_BCap_Seg chart shows MGP's share of the alcohol and food industry production infrastructure.

Market segment balance sheet capitalization - Narco food

As the chart shows, beverage production requires significant investment in factories. MGP Ingredients is a unique player. Its business is distillation on an industrial scale. This makes it extremely capital-intensive, as its giant distilleries are its main asset.

Book value of all companies included in the broad market index - GURU.Markets

MGP Ingredients is one of the largest producers of distilled spirits and industrial ingredients in the United States. The company's assets include massive distilleries that are the source of many renowned whiskey and vodka brands. The chart below illustrates the physical scale of this "spirits giant."

The ratio of market capitalization to book capitalization of a company, segment, and the market as a whole

Market capitalization to book capitalization ratio - MGP Ingredients, Inc.

MGP Ingredients' balance sheet is its massive distilleries. The market values โ€‹โ€‹the company at a premium, seeing it not just as a supplier of spirits, but as the owner of a growing portfolio of its own whiskey and vodka brands. The chart shows how the market values โ€‹โ€‹this transition from "raw materials" to the final "product."

Market to book capitalization ratio in a market segment - Narco food

MGP Ingredients, Inc. is a leading producer of distilled spirits (such as whiskey) and plant-based proteins. Its business relies on large production facilities. This chart shows how the market values โ€‹โ€‹its unique combination of a stable spirits business and a growing food segment relative to its assets.

Market to book capitalization ratio for the market as a whole

MGP Ingredients is a diversified producer, one of the largest suppliers of distilled spirits (whiskey, gin) to other brands, and also produces food ingredients. Its value lies in its combination of production capacity and expertise. The chart shows how the market values โ€‹โ€‹this key, yet often overlooked, player in the beverage industry.

Debts of the company, segment and market as a whole

MGPI - Company debts MGP Ingredients, Inc.

MGP Ingredients, a producer of alcoholic beverages and food ingredients, is using debt to finance its transformation into a company with a portfolio of its own brands. Following the acquisition of Luxco, this chart shows how the company is managing its balance sheet to support both contract manufacturing and the development and marketing of its whiskey and other spirits brands.

Market segment debts - Narco food

MGP Ingredients is a unique company, a leading supplier of distilled spirits for whiskey and gin production, as well as a producer of its own brands of spirits and food ingredients. This chart shows how the company's debt load has changed following strategic acquisitions aimed at expanding its portfolio of private labels and increasing margins.

Market debt in general

Debt to book value of the company, segment and market as a whole

The company's debt to book capitalization ratio MGP Ingredients, Inc.

MGP Ingredients is a mature beverage and food ingredients company with stable cash flow. Debt can be used to optimize capital, modernize production, or acquire new brands. This chart illustrates the financial policies of a stable company that can afford to manage debt to its advantage.

Market segment debt to market segment book capitalization - Narco food

MGP Ingredients, a producer of distilled spirits (a key supplier to craft whiskey brands) and specialty food ingredients. This chart compares the company's debt to the total capitalization of its entire food sector. It shows how a company with a diversified and stable business manages its capital, balancing its two distinct segments.

Debt to book value of all companies in the market

MGP Ingredients is a unique company producing distilled spirits and specialty food ingredients. It's a stable business that can leverage debt to modernize production or make strategic acquisitions. This chart compares the company's conservative financial approach with overall market trends and assesses its financial stability.

P/E of the company, segment and market as a whole

P/E - MGP Ingredients, Inc.

This metric for MGP Ingredients reflects the valuation of a unique business that is a leading supplier of distilled spirits to other brands and also produces its own whiskey labels. Profits depend on demand for craft spirits and industrial ingredients. The chart shows how investors view its diversified and stable business model.

P/E of the market segment - Narco food

MGP Ingredients is a producer of distilled spirits (whiskey, gin) and specialty wheat-based food ingredients. The company supplies many well-known brands. This chart reflects the average rating in the beverage and food ingredients sector, where demand stability and production expertise are valued.

P/E of the market as a whole

MGP Ingredients is a unique company, a leading supplier of distilled spirits for whiskey and gin production, as well as a producer of plant-based proteins. This chart reflects general consumer trends. Comparisons with it help understand how the market views this dual business: as a stable supplier to the spirits industry or as a player in the growing food ingredients sector.

Future P/E of the company, segment and market as a whole

Future (projected) P/E of the company MGP Ingredients, Inc.

This chart for MGP Ingredients, a producer of spirits and food ingredients, shows analysts' expectations for future profitability. It reflects forecasts for consumer demand for alcoholic beverages and specialty ingredients, allowing one to assess the stability and growth of the company's business going forward.

Future (projected) P/E of the market segment - Narco food

MGP Ingredients is a producer of distilled spirits for craft and large brands, as well as food ingredients. The data on the chart reflects the average estimated future growth in the food sector. MGPI's position may indicate investor perceptions of the stability of its business and its ability to capitalize on the craft spirits and plant-based protein trends.

Future (projected) P/E of the market as a whole

MGP Ingredients is a producer of alcoholic beverages and food ingredients. Demand for its products is relatively stable, but still influenced by consumer confidence. This graph of general economic expectations indirectly indicates how consumers will spend money on premium alcohol and food products.

Profit of the company, segment and market as a whole

Company profit MGP Ingredients, Inc.

MGP Ingredients produces distilled spirits (whiskey, gin) for other brands, as well as food ingredients such as plant-based proteins. This chart demonstrates its diversified business model. Profit growth is driven by both trends in the craft spirits industry and the growing demand for health-promoting nutritional supplements.

Profit of companies in the market segment - Narco food

MGP Ingredients is a unique combination of two businesses: one of the largest US suppliers of distilled spirits to craft brands and a food ingredients producer. The sector's profitability is driven by healthy eating trends and the growing popularity of craft spirits. This chart shows how the company benefits from diversification, serving two major consumer markets simultaneously.

Overall market profit

MGP Ingredients, a producer of distilled spirits and plant proteins, sits at the intersection of two worlds. Demand for alcoholic beverages is relatively stable throughout the economic cycle, as shown in the graph. However, the food ingredients segment is more sensitive to consumer trends and the willingness of food manufacturers to invest in new formulas.

Future (predicted) profit of the company, segment and market as a whole

Future (projected) profit of the company MGP Ingredients, Inc.

MGP Ingredients is a producer of distilled spirits and food ingredients. This chart shows analysts' profit forecasts, which are dependent on demand for craft spirits and specialty beverages, as well as grain prices. This estimate assesses the company's ability to balance raw material supplies with the development of its own brands.

Future (predicted) profit of companies in the market segment - Narco food

MGP Ingredients is a major producer of distilled spirits (whiskey, gin) for other brands, as well as food ingredients. The company is the "eminence grise" of the alcohol industry. This chart shows the profit forecast for the food sector, which for MGPI is an indicator of overall consumer demand for alcoholic beverages and specialty food products.

Future (predicted) profit of the market as a whole

MGP Ingredients produces distilled spirits and food ingredients. Demand for its products is relatively stable, as they are in the consumer sector. However, even in this niche, an economic downturn could lead consumers to switch to cheaper brands, which could indirectly impact order volumes from beverage and food manufacturers.

P/S of the company, segment and market as a whole

P/S - MGP Ingredients, Inc.

MGP Ingredients is a unique business, a leading supplier of distilled spirits to craft whiskey and gin producers, as well as plant-based proteins. Its revenue is driven by trends in the alcohol industry and the demand for plant-based foods. The chart shows the valuation of this diversified business, where every dollar of sales is generated at the intersection of tradition and innovation.

P/S market segment - Narco food

MGP Ingredients is a leading producer of distilled spirits (whiskey, gin) for other brands and a supplier of food ingredients. The chart shows the average revenue estimate in the food industry. It allows one to assess how the market values โ€‹โ€‹the company's unique business model, which combines contract manufacturing and its own brands, compared to its competitors.

P/S of the market as a whole

MGP Ingredients is a leading supplier of distilled spirits to alcoholic beverage and industrial product manufacturers. It operates a stable business behind the scenes for well-known brands. This chart helps assess how the market values โ€‹โ€‹this B2B model with predictable revenue compared to riskier and faster-growing sectors of the economy.

Future P/S of the company, segment and market as a whole

Future (projected) P/S of the company MGP Ingredients, Inc.

MGP Ingredients is a leading supplier of premium distilled spirits (the base for whiskey and gin) and specialty protein ingredients to the food industry. The chart shows a market estimate based on expected future sales in both the growing spirits segment and the stable food ingredients business.

Future (projected) P/S of the market segment - Narco food

MGP Ingredients is a producer of distilled spirits for craft and large brands, as well as food ingredients. This chart shows the average estimated future revenue for food industry companies. It helps understand how the market views MGP's unique business model, which combines alcohol and ingredients production, against the backdrop of overall industry trends.

Future (projected) P/S of the market as a whole

MGP Ingredients is a producer of distilled spirits and food ingredients. Its business combines stability and growth. This overall revenue expectation chart is important for its branded beverages segment, which depends on consumer confidence. At the same time, ingredient supplies provide more predictable and stable revenue.

Sales of the company, segment and market as a whole

Company sales MGP Ingredients, Inc.

MGP Ingredients operates in two businesses: producing distilled spirits for other brands and creating specialized food ingredients. This chart combines revenue from both businesses. It allows us to assess demand both in the craft alcohol market, where the company is a key supplier, and in the food industry, which consumes its proteins and starches.

Sales of companies in the market segment - Narco food

MGP Ingredients is a unique company, a leading supplier of distilled spirits for whiskey and gin production, and also produces specialty proteins and starches for the food industry. This business combines tradition and innovation. This chart shows the sector's total revenue, allowing you to assess overall trends in the alcoholic beverages and food ingredients market.

Overall market sales

MGP Ingredients is a manufacturer of distilled spirits and food ingredients. This chart reflects overall consumer spending. Demand for alcoholic beverages and prepared foods is relatively stable but also depends on disposable income. MGPI supplies key ingredients to many well-known brands, making it a vital part of the food industry.

Future sales volume of the company, segment and market as a whole

Future (projected) sales of the company MGP Ingredients, Inc.

MGP Ingredients is a producer of distilled spirits (the base for many brands of whiskey and vodka) and specialty food ingredients. Demand for its products depends on trends in the alcohol industry and the food market. This chart shows forecasts for growth in craft alcohol and plant-based protein consumption.

Future (projected) sales of companies in the market segment - Narco food

MGP Ingredients is a unique company, a major producer of distilled spirits (whiskey, gin) for other brands, as well as protein-based food ingredients. The chart shows projected revenue for the food and beverage sector. MGP's diversified business model provides it with stability and growth potential.

Future (projected) sales of the market as a whole

MGP Ingredients is a producer of distilled spirits and food ingredients. Demand for its products depends on consumer spending on alcoholic beverages and food products. This chart, reflecting overall consumer sentiment, provides insight into future sales. During periods of economic growth, people spend more on premium products, which benefits MGPI.

Marginality of the company, segment and market as a whole

Company marginality MGP Ingredients, Inc.

MGP Ingredients is a unique company producing both distilled spirits for renowned brands and food ingredients. Their profitability depends on raw material (grain) prices and demand in both segments. This chart shows how effectively the company manages its diversified production to achieve stable profits.

Market segment marginality - Narco food

MGP Ingredients is a leading supplier of distilled spirits (whiskey, gin) for other brands and also produces its own alcoholic beverages and food ingredients. This chart shows the average profitability in the food industry. Its unique market position and business diversification allow the company to maintain stable and high margins.

Market marginality as a whole

MGP Ingredients is a producer of distilled spirits for craft brands and food ingredients. Its business combines the stability of the food sector with the growing popularity of unique spirits. This total profitability chart helps evaluate how the company, operating at the intersection of traditional production and trendy consumer trends, maintains its profitability.

Employees in the company, segment and market as a whole

Number of employees in the company MGP Ingredients, Inc.

MGP Ingredients is a major producer of alcohols and food ingredients. It's a classic manufacturing business. The team size shown in this chart is directly related to the utilization and capacity of its plants. An increase in this indicator may indicate production expansion or strategic acquisitions in related industries.

Share of the company's employees MGP Ingredients, Inc. within the market segment - Narco food

MGP Ingredients is a diversified manufacturer known for its supply of spirits for craft whiskey and gin, as well as food ingredients. It is a large industrial producer. This chart clearly demonstrates the company's scale in the real sector, reflecting its share of the food and alcohol industry as an employer, which indicates the size of its production capacity.

Number of employees in the market segment - Narco food

MGP Ingredients, Inc. is a leading producer of distilled spirits (whiskey, gin) and specialty wheat proteins and starches. The headcount chart reflects demand in two distinct segments. Growth may be driven by both the craft alcohol boom and the increasing demand for plant-based proteins in the food industry, demonstrating business diversification.

Number of employees in the market as a whole

MGP Ingredients, Inc. produces alcoholic beverages and food ingredients. This total employment chart reflects consumer financial health. During periods of economic stability and rising incomes, people are more likely to indulge in premium beverages and high-quality food products, which directly increases demand for MGP's high-quality products.

Market capitalization per employee (in thousands of dollars) of the company, segment, and market as a whole

Market capitalization per employee (in thousands of dollars) of the company MGP Ingredients, Inc. (MGPI)

MGP Ingredients is a diversified producer of alcoholic beverages and food ingredients. It's a traditional manufacturing business, requiring factories, warehouses, and personnel. This chart shows a typical industry trend: moderate capitalization per employee, reflecting the balance between the value of brands, assets, and labor costs.

Market capitalization per employee (in thousands of dollars) in the market segment - Narco food

MGP Ingredients is a unique combination of distilled spirits and specialty food ingredients. Its production requires significant capacity and personnel, which distinguishes it from purely technology companies. This chart allows us to evaluate its market capitalization per employee in the context of the real-world manufacturing sector.

Market capitalization per employee (in thousands of dollars) for the overall market

MGP Ingredients is a producer of distilled spirits (such as whiskey) and plant proteins. It is an industrial business with a long history. This chart shows the valuation of a stable manufacturing company. It reflects how market value relates to the personnel managing large production facilities.

Profit per employee (in thousands of dollars) for the company, segment, and market as a whole

Profit per employee (in thousands of dollars) of the company MGP Ingredients, Inc. (MGPI)

MGP Ingredients is a dual-faceted company: a major spirits producer (including distillates for other brands) and a food ingredients supplier. This chart averages the performance of both segments. It shows how much net profit each employee generates at their distilling and production facilities. This is an indicator of operational efficiency in a mature industry.

Profit per employee (in thousands of dollars) in the market segment - Narco food

MGP Ingredients (MGPI) is a producer of "spirits" (for whiskey) and "branded" spirits. This chart shows the benchmark for the "Alcohols" sector. The average profit per employee here is high. It is a "branded business" (premium spirits) and a "commodity" (spirits). The benchmark reflects the balance of these two models.

Profit per employee (in thousands of dollars) for the market as a whole

MGP Ingredients is a major producer of distilled spirits (whiskey, gin) for other brands, as well as food ingredients. This B2B operation requires factories, aging warehouses, and distillation expertise. This chart shows the efficiency of this capital-intensive production process: how much profit each factory and laboratory employee generates.

Sales to employees of the company, segment and market as a whole

Sales per company employee MGP Ingredients, Inc. (MGPI)

MGP Ingredients is a major producer of alcoholic beverages and food ingredients. This chart reflects the efficiency of its production and distribution operations. The increase in revenue per employee may be due to automation at its plants, increased production volumes, or successful marketing that increases product value.

Sales per employee in the market segment - Narco food

MGP Ingredients (MGPI) has two main segments: distilling spirits (whiskey, vodka) for other brands and producing its own branded spirits. It's a manufacturing business. This chart shows their efficiency. Bulk production (Distilling Solutions) requires fewer personnel per dollar of revenue than marketing and selling its own brands (Branded Spirits).

Sales per employee for the market as a whole

MGP Ingredients is two businesses in one: premium spirits (brands) and ingredients (spirits, proteins). This metric helps evaluate the performance of both segments. Distillation is a capital-intensive process, not labor-intensive, resulting in high revenue per employee. The branded segment requires more marketing and sales.

Short shares by company, segment and market as a whole

Shares shorted by company MGP Ingredients, Inc. (MGPI)

MGP Ingredients (MGPI) is two businesses in one: a large contract producer of spirits (whiskey, gin) for other brands and a supplier of specialty food ingredients (proteins, starch). This metric measures skepticism. Are the "bears" betting on a decline in the popularity of craft alcohol or are they seeing their ingredients business slowing?

Shares shorted by market segment - Narco food

MGP Ingredients (MGPI) is a two-faced company: it is a leading supplier of spirits (for vodka) and whiskey for other brands, and also owns its own brands (Tito's Handmade Vodka). This chart shows the odds against the alcohol sector. Rising odds against the industry may indicate that investors expect consumer spending on premium spirits to decline.

Shares shorted by the overall market

MGP Ingredients (MGPI) is a diversified manufacturer. They are a leading supplier of distilled spirits (for whiskey brands) and specialty ingredients for the food industry. This chart shows the general fear. When it rises, investors fear a recession. This could hit MGPI in two ways: a decline in demand for premium alcohol and a reduction in orders from food companies.

RSI 14 indicator for a company, segment, and market as a whole

The company's RSI 14 indicator MGP Ingredients, Inc. (MGPI)

MGP Ingredients is a unique business. They are a wholesale producer of whiskey and gin for many craft brands, and also own their own private labels. This chart measures how the market values โ€‹โ€‹this spirits business. It shows when the stock is overbought due to rising demand or oversold due to fears of oversupply.

RSI 14 Market Segment - Narco food

MGP Ingredients is a leading producer of distilled spirits (whiskey, gin) for other brands, as well as specialty food ingredients (proteins, starches). This indicator reflects the overall health of the alcoholic beverage sector and helps understand whether the entire segment is oversold amid stable demand for premium spirits.

RSI 14 for the overall market

MGP Ingredients (MGPI), a producer of distilled spirits (for other brands) and its own brands, demonstrates its "defensive" nature. Alcohol is bought in both euphoria and panic. During times of panic, investors value this stable, non-cyclical demand, ignoring the "boring" MGPI stock during periods of euphoria.

Analyst consensus forecast for the company's share price, the segment, and the market as a whole

Analyst consensus stock price forecast MGPI (MGP Ingredients, Inc.)

MGP Ingredients is a major producer of distilled spirits (whiskey, gin) for other brands, as well as its own premium beverages and food ingredients. This chart shows the average analyst forecast. Their targets are based on a balance between a stable ingredients business and growth in the high-margin branded spirits segment.

The difference between the consensus estimate and the actual stock price MGPI (MGP Ingredients, Inc.)

MGP Ingredients (MGPI) is a company with two faces. Their old business is B2B spirits production (they make whiskey and gin for hundreds of other craft brands). Their new business is owning their own brands (Luxco, Titos). This chart shows how much analysts believe in their transformation into a branded company.

Analyst consensus forecast for stock prices by market segment - Narco food

MGP Ingredients is a unique company: it's the largest contract producer of whiskey and spirits (for competing brands) in the US, also owning its own brands (Tito's). This chart shows general expectations for the spirits sector. It reflects whether experts believe demand for premium spirits will grow.

Analysts' consensus forecast for the overall market share price

MGP Ingredients is one of the largest hidden giants in the US spirits industry. They produce whiskey, gin, and vodka for many well-known brands, as well as food ingredients. This chart shows the overall market sentiment. For MGPI, whose business is somewhat defensive (demand for alcohol is stable), the overall optimism is important, as it supports demand for premium drinks, where margins are higher.

AKIMA index of the company, segment and market as a whole

AKiMA Company Index MGP Ingredients, Inc.

MGP Ingredients (MGPI) is a unique hybrid. Historically, they were an invisible B2B producer of spirits (whiskey, gin) for other brands. Now, they are actively building their own portfolio of premium spirits brands. This chart assesses their transformation, weighing their stable B2B distilling business against their higher-margin, but competitive, branded business.

AKIMA Market Segment Index - Narco food

MGP Ingredients (MGPI) is a unique spirits holding company; the company is an undisclosed leader (B2B) in spirits production (distilling whiskey and vodka for other brands) and owns its own brands (Luxco). This aggregate metric evaluates companies. The graph shows the sector average. This benchmark: how does this hybrid (B2B + B2C) model (MGPI) differentiate it from the average competitor?

The AKIM Index for the overall market

MGP Ingredients is a leading supplier of distilled spirits (whiskey, gin) and food ingredients for branded goods (B2B). This chart, reflecting the market average, is a backdrop. It helps assess how this "defensive" business, dependent on whiskey maturation cycles, stacks up against the backdrop of overall macroeconomic fluctuations.