The company's competitors:ACNINFYCTSHWITCDWGIBSNXGINGMOSNSITDXCPLUSCNXNSIFYCLMBRMNIRXTUISIIIMHHWYYHKITKMRKCLPSAERTMGRTSCWX

GURU.Markets stock price, segment price, and overall market index valuation

The company's share price Polibeli Group Ltd

Polibeli, an IT outsourcing company, is valued based on its ability to win software development and support contracts. Its valuation depends on the demand for IT services, the availability of qualified personnel, and global market competition.

Share prices of companies in the market segment - It outsourcing

Polibeli Group is an Indonesian e-commerce platform focused on serving rural areas using a social retail model. We've tentatively classified it in the "IT Outsourcing" sector for classification purposes. The chart below shows the performance of tech companies in emerging markets.

Broad Market Index - GURU.Markets

Polibeli Group is an Indonesian company that provides IT outsourcing and consulting services to businesses. Its operations are part of the market reflected in the GURU.Markets index. The chart below shows the overall performance of this technology sector.

Change in the price of a company, segment, and market as a whole per day

PLBL - Daily change in the company's share price Polibeli Group Ltd

Polibeli Group Ltd's daily price change reflects volatility in Indonesia's growing IT outsourcing market. This indicator is a measure of sensitivity to regional economic growth and competitive environment, serving as a valuable tool for analysis.

Daily change in the price of a set of shares in a market segment - It outsourcing

The IT outsourcing sector, in which Polibeli Group Ltd operates, is highly dynamic. This chart reflects the average volatility of the industry. It serves as a benchmark for assessing Polibeli's business's sensitivity to general trends, demand for IT services, and competition.

Daily change in the price of a broad market stock, index - GURU.Markets

Polibeli Group is an Indonesian company providing IT services and business solutions. Its shares reflect the pace of digitalization in one of Southeast Asia's largest economies. The dynamics of such international companies add a global dimension to the overall volatility of the American market.

Dynamics of market capitalization of the company, segment and the market as a whole over 12 months

Annual dynamics of the company's market capitalization Polibeli Group Ltd

Polibeli Group Ltd's year-over-year performance tells the story of its role in the IT outsourcing and digital services market. Its market capitalization change over the past 12 months reflects its ability to attract new clients, effectively manage projects, and adapt to rapid technological change, all of which are key to its growth and profitability.

Annual dynamics of market capitalization of the market segment - It outsourcing

Polibeli, as a private IT outsourcing company, likely specializes in niche technologies or markets. Its growth depends on its ability to win contracts and retain talent. Its valuation dynamics will reflect its success in this area, potentially outperforming the sector if its expertise proves in demand.

Annual dynamics of market capitalization of broad market stocks, index - GURU.Markets

Polibeli Group appears to be privately held or defunct. The ticker symbol PLBL is inactive. Analysis of its market performance is impossible. If such a company existed in the IT outsourcing sector, its business could be countercyclical, as demand for its services rises as companies seek to reduce costs.

Dynamics of market capitalization of the company, segment and the market as a whole for the month

Monthly dynamics of the company's market capitalization Polibeli Group Ltd

Polibeli Group, operating in the IT outsourcing sector, relies on corporate technology spending. Its monthly growth reflects its success in securing long-term service contracts. Quarterly reports demonstrating revenue and profitability growth serve as the primary indicator of its operational effectiveness.

Monthly dynamics of market capitalization of the market segment - It outsourcing

Polibeli Group is an Indonesian company providing IT services and business outsourcing. Its success is linked to the digitalization of the Southeast Asian economy. The chart below shows the overall dynamics of the IT services sector, but with an adjustment for the specifics of fast-growing emerging markets.

Monthly dynamics of market capitalization of broad market stocks, index - GURU.Markets

Polibeli Group is an Indonesian IT company. Its shares reflect the state of the Indonesian technology sector and economy. The company's performance is determined entirely by local and regional factors, such as the growth of digitalization in Southeast Asia, and is not tied to trends in the American or European markets.

Dynamics of market capitalization of the company, segment and the market as a whole for the week

Weekly dynamics of the company's market capitalization Polibeli Group Ltd

Polibeli Group's shares, an IT outsourcing company, reflect the state of the tech sector on a weekly basis. Price movements reflect demand for IT services, corporate budgets, and the company's ability to compete in the global software development market.

Weekly dynamics of market capitalization of the market segment - It outsourcing

Polibeli Group operates in the IT outsourcing sector. Demand for its services depends on companies' desire to optimize their business processes and reduce costs. The chart below helps determine whether the company's stock follows general trends in the IT services sector or whether its specialization and client base are creating its own market profile.

Weekly dynamics of market capitalization of stocks of the broad market, index - GURU.Markets

Polibeli Group operates in the IT outsourcing sector. Its business relies on corporate IT budgets. The chart below shows how PLBL shares react to overall market sentiment, reflecting companies' willingness to invest in digitalization in the current economic climate.

Market capitalization of the company, segment and market as a whole

PLBL - Market capitalization of the company Polibeli Group Ltd

Polibeli's market capitalization, as an Indonesian IT outsourcer, would be a story about the growth of the digital economy in Southeast Asia. Its valuation dynamics would reflect its ability to attract clients, recruit qualified professionals, and compete with global and local players in a fast-growing but fragmented market.

PLBL - Share of the company's market capitalization Polibeli Group Ltd within the market segment - It outsourcing

Polibeli Group is a company operating in the IT outsourcing and digital services sector. Its market capitalization in the tech sector reflects its current business scale and client base. The chart shows its weight and competitive position in a market where companies are looking to outsource their IT functions.

Market capitalization of the market segment - It outsourcing

Polibeli Group is a company operating in the IT outsourcing and technology services sector. The chart below shows the total market capitalization of this global sector. Its growth reflects the trend toward digital transformation, in which Polibeli is trying to find its niche by offering its services to businesses.

Market capitalization of all companies included in a broad market index - GURU.Markets

Polibeli Group is an IT outsourcing company. Market capitalization in this sector reflects the extent to which a business is willing to outsource its technological tasks to improve efficiency. The performance of such a company on the overall chart is an indicator of globalization and specialization in the IT world.

Book value capitalization of the company, segment and market as a whole

PLBL - Book value capitalization of the company Polibeli Group Ltd

Polibeli Group's foundation is its capital and technology platform, focused on providing IT services and solutions in the Asian market. Its book value reflects the financial position of this young IT outsourcing company. How has this asset changed since its market launch? The chart below shows its initial performance.

PLBL - Share of the company's book capitalization Polibeli Group Ltd within the market segment - It outsourcing

Polibeli Group, operating in the IT sector, utilizes offices and server infrastructure to provide its services. The chart shows the share of these tangible assets in the sector, reflecting the physical foundation upon which its operations are built.

Market segment balance sheet capitalization - It outsourcing

IT outsourcing, like Polibeli Group's, is a service business built on people and technology. A balance sheet capitalization chart shows that the company isn't capital-intensive; its main assets are its contracts and its team of specialists.

Book value of all companies included in the broad market index - GURU.Markets

Polibeli Group Ltd. operates in the IT outsourcing and consulting industry. The company's book value is represented by its development offices, technological infrastructure, and staff. The chart shows the material foundation that supports the intellectual capital of this service company.

The ratio of market capitalization to book capitalization of a company, segment, and the market as a whole

Market capitalization to book capitalization ratio - Polibeli Group Ltd

Polibeli Group is an IT outsourcer. Its value lies in its team and contracts. The chart shows the premium (or discount) the market is willing to pay for its ability to compete in the global IT services market.

Market to book capitalization ratio in a market segment - It outsourcing

Polibeli Group is likely an IT outsourcing company. Value in this sector is created through qualified personnel and long-term contracts. The chart shows how the market evaluates its ability to provide high-quality IT services and retain clients.

Market to book capitalization ratio for the market as a whole

Polibeli Group, judging by its name, could be an Indonesian company operating in the IT or e-commerce sectors. The valuation of such companies depends on their growth in the domestic market. This chart shows general global trends, but how do investors value a player operating in one of Southeast Asia's fastest-growing digital economies?

Debts of the company, segment and market as a whole

PLBL - Company debts Polibeli Group Ltd

For an IT outsourcing company like Polibeli Group, the financial strategy is likely focused on scaling. Capital may be raised to hire large numbers of specialists for new projects, to acquire small IT teams, or to manage working capital for large clients.

Market segment debts - It outsourcing

Polibeli Group appears to operate in the IT outsourcing or digital services sector. This business is based on intellectual capital rather than physical assets. This chart illustrates how capital-intensive its business model is and how it finances its growth in the service economy.

Market debt in general

Debt to book value of the company, segment and market as a whole

The company's debt to book capitalization ratio Polibeli Group Ltd

Polibeli Group, which operates in IT outsourcing or e-commerce, can use capital to expand its staff or invest in its platform. This chart shows its financial structure. For a service or technology company, debt can be a tool for rapid scaling, and this metric reflects the aggressiveness of its growth strategy.

Market segment debt to market segment book capitalization - It outsourcing

Polibeli Group likely operates in IT outsourcing or related services in Southeast Asia. This chart shows the debt burden in the IT services sector. It allows one to assess how companies in this industry finance their growth and how their financial model compares to their global and regional peers.

Debt to book value of all companies in the market

Polibeli Group, operating in Indonesia, is likely involved in IT outsourcing or e-commerce. Such business models typically don't require large amounts of physical assets. A chart of the market's total debt load helps us understand how such tech companies can be financially flexible and grow through intellectual capital rather than debt.

P/E of the company, segment and market as a whole

P/E - Polibeli Group Ltd

This chart for Polibeli Group, an IT company, shows how investors view its business. This metric reflects expectations about its ability to provide in-demand IT services, whether software development, outsourcing, or consulting, in a rapidly changing technology landscape.

P/E of the market segment - It outsourcing

IT services, which Polibeli likely provides, are a competitive market. This chart shows the average valuation for IT services companies. It serves as a benchmark for understanding how investors might value Polibeli based on its specializationβ€”software development, consulting, or outsourcingβ€”and its growth potential.

P/E of the market as a whole

Polibeli Group Ltd. is likely an IT company, possibly operating in the Southeast Asian market (judging by the .id domain, Indonesia), and providing outsourcing or software development services. This chart, reflecting global technology trends, provides insight into investor sentiment regarding the prospects for IT outsourcing in developing regions.

Future P/E of the company, segment and market as a whole

Future (projected) P/E of the company Polibeli Group Ltd

Polibeli Group β€” (Note: Company information is very limited). For an IT outsourcing company, its market valuation would reflect expected growth in demand for its services, its ability to attract and retain qualified specialists, and the competitive environment in the global IT services market.

Future (projected) P/E of the market segment - It outsourcing

Polibeli Group is an Indonesian company operating in the IT outsourcing sector. This chart shows average profitability expectations for the sector. It provides insight into investor perceptions of its business model, the competitive landscape in the Indonesian IT services market, and its growth potential in one of the world's fastest-growing digital economies.

Future (projected) P/E of the market as a whole

Polibeli Group Ltd. is likely a company operating in the IT outsourcing or related services sector. This chart measures overall investor optimism. For a company whose business depends on other companies' willingness to outsource their IT functions, it is an indicator of corporate confidence and a desire to optimize costs.

Profit of the company, segment and market as a whole

Company profit Polibeli Group Ltd

Polibeli Group Ltd is likely an IT outsourcing or consulting company. Its net revenue, shown in the graph, depends on the number and size of client contracts. This trend reflects the demand for IT services and the company's ability to provide qualified specialists and business solutions.

Profit of companies in the market segment - It outsourcing

Polibeli Group is likely an IT outsourcing or e-commerce company in Southeast Asia. Profitability in these sectors depends on the ability to provide high-quality services at competitive prices or effectively manage online retail. This chart shows general economic trends in the region and their impact on IT and retail.

Overall market profit

Polibeli Group Ltd is a company operating in the information technology and outsourcing market. Its success depends on businesses' willingness to outsource their IT functions to improve efficiency. The growth of such companies reflects the trend toward specialization and cost optimization in the corporate sector, which intensifies during periods of economic maturity, as shown in this graph.

Future (predicted) profit of the company, segment and market as a whole

Future (projected) profit of the company Polibeli Group Ltd

Polibeli Group Ltd is a company operating in the field of IT outsourcing and related services. The profit forecast in this chart depends on demand for IT services, the ability to win contracts, and competition in the technology outsourcing market.

Future (predicted) profit of companies in the market segment - It outsourcing

Polibeli Group is likely an IT outsourcing company or systems integrator operating in the Southeast Asian market (Indonesia), providing technology services to businesses. This chart shows the revenue forecast for the IT outsourcing sector, allowing one to assess how the company competes in a growing and technology-intensive market.

Future (predicted) profit of the market as a whole

Polibeli Group likely operates in IT outsourcing or e-commerce in Southeast Asia. The success of such companies depends on economic growth in the region. This graph, reflecting global trends, influences emerging markets and the willingness of local businesses to invest in IT or consumer spending.

P/S of the company, segment and market as a whole

P/S - Polibeli Group Ltd

Polibeli Group is an IT outsourcing services company. This chart shows how the market values ​​its revenue, which depends on business demand for outsourced IT resources. This value reflects the competitive environment and the company's ability to deliver high-quality services.

P/S market segment - It outsourcing

Polibeli Group is a technology company operating in IT outsourcing and digital services. This chart shows the average revenue valuation in the technology sector. It helps understand how investors view the company's business model, its client base, and its ability to provide in-demand IT services in a competitive market.

P/S of the market as a whole

Polibeli Group is a technology company providing IT outsourcing services and developing software solutions for businesses in Southeast Asia. This overall market valuation chart compares how investors value IT companies in fast-growing emerging markets against the backdrop of global technology trends.

Future P/S of the company, segment and market as a whole

Future (projected) P/S of the company Polibeli Group Ltd

Polibeli Group likely operates in the IT or e-commerce sector in Southeast Asia. This chart shows the company's valuation relative to its projected future revenue. It reflects investor expectations for its ability to grow in the region's dynamic digital market and successfully monetize its services.

Future (projected) P/S of the market segment - It outsourcing

Polibeli Group is likely an IT company operating in the Indonesian market, possibly in outsourcing or software development. This chart reflects investor expectations for its business model and growth potential in the emerging Southeast Asian technology market.

Future (projected) P/S of the market as a whole

Polibeli Group is an IT outsourcing company. Its success depends on companies' willingness to outsource their IT functions to improve efficiency. This graph of general expectations is important for PLBL. Economic growth and optimism encourage companies to invest in development, which often includes optimizing IT costs through outsourcing.

Sales of the company, segment and market as a whole

Company sales Polibeli Group Ltd

This chart reflects the initial stages of a company's development in digital technologies. For Polibeli Group, it shows early revenue from IT services or software development. Its future growth will depend on successful client acquisition and business scaling.

Sales of companies in the market segment - It outsourcing

Polibeli Group Ltd. is an IT outsourcing company, likely based in Southeast Asia. It helps other companies manage their IT infrastructure and development. This chart shows revenue from IT outsourcing. Polibeli's services are part of a global trend where businesses outsource non-core IT tasks.

Overall market sales

Polibeli Group is a company operating in the IT outsourcing market. Demand for its services is an indicator of how actively businesses are investing in digital technologies and striving to optimize their costs. The growth of outsourcing companies reflects the global trend toward specialization and flexibility in IT resource management.

Future sales volume of the company, segment and market as a whole

Future (projected) sales of the company Polibeli Group Ltd

Polibeli Group is an IT company providing outsourcing and software development services. Its future sales forecast depends on global demand for IT services and its ability to attract and fulfill contracts.

Future (projected) sales of companies in the market segment - It outsourcing

Polibeli Group Ltd. is a company operating in the IT outsourcing sector. The forecast for this sector reflects the global trend of outsourcing non-core IT functions. This chart shows how willing companies are to invest in outsourcing to reduce costs and access specialized expertise.

Future (projected) sales of the market as a whole

Polibeli Group likely operates in e-commerce or IT outsourcing in Southeast Asia. Success in these areas depends on the growth of the digital economy and consumer spending. This global trends chart is important, but for the company, the key factors are the economic conditions and pace of digitalization in its target region.

Marginality of the company, segment and market as a whole

Company marginality Polibeli Group Ltd

Polibeli Group likely operates in the IT outsourcing or digital services sector, possibly in the Southeast Asian market. Profitability in this business depends on the ability to win contracts and effectively manage teams of developers and specialists. This chart shows how successfully the company monetizes its technology services.

Market segment marginality - It outsourcing

Polibeli Group Ltd operates in the IT outsourcing sector, providing technology services and solutions for businesses. Profitability in this sector depends on client acquisition costs, service rates, and effective project and personnel management. This chart allows you to evaluate the company's operating model in comparison to other IT service providers.

Market marginality as a whole

Polibeli Group Ltd is a company operating in the IT outsourcing sector. This chart shows overall profitability. It illustrates Polibeli's business model, whose profitability depends on its ability to attract and complete projects for clients. This is a competitive market, where margins depend on labor costs and the complexity of the services provided.

Employees in the company, segment and market as a whole

Number of employees in the company Polibeli Group Ltd

Polibeli Group likely operates in the IT services or outsourcing sector in Indonesia. Its team size will reflect the number and scale of its client projects. Growth on this chart would indicate successful acquisition of new clients and expansion of its IT services offering in the rapidly growing Southeast Asian market.

Share of the company's employees Polibeli Group Ltd within the market segment - It outsourcing

Polibeli Group is likely an Indonesian company operating in the IT outsourcing or digital services sector. This graph would show its talent pool in the region. It would reflect the share of IT specialists, developers, and project managers in the Indonesian technology services sector the company draws on to serve its clients.

Number of employees in the market segment - It outsourcing

Polibeli Group Ltd is an IT outsourcing company. This chart reflects the global trend of outsourcing technology tasks to specialized contractors. The growing number of developers and system administrators at such companies demonstrates that businesses of all sizes are seeking access to qualified IT personnel without having to hire them in-house.

Number of employees in the market as a whole

Polibeli Group Ltd is an Indonesian IT company. Its success depends entirely on the state of the economy and the pace of digitalization in Southeast Asia. The employment schedule in the US is irrelevant to them. The key factors are growing internet penetration, the development of e-commerce, and demand for IT services in their target region.

Market capitalization per employee (in thousands of dollars) of the company, segment, and market as a whole

Market capitalization per employee (in thousands of dollars) of the company Polibeli Group Ltd (PLBL)

Polibeli Group is a company operating in the IT outsourcing and digital services sector. Talented specialists are a key asset in this business. This chart shows that the cost per employee in IT services reflects the team's qualifications, the availability of long-term contracts, and the company's ability to effectively manage projects and deliver high-quality services.

Market capitalization per employee (in thousands of dollars) in the market segment - It outsourcing

Polibeli Group is likely an IT company, possibly from Southeast Asia, operating in the outsourcing or e-commerce sectors. This chart will help us understand its model: whether it is a highly automated technology platform or a service business whose success depends on a large number of skilled employees.

Market capitalization per employee (in thousands of dollars) for the overall market

Polibeli Group likely operates in the IT services or outsourcing industry. In this business, the ability to attract and retain talented professionals is key to success. This chart shows how the market values ​​a service company, whose value depends on the quality of its human capital.

Profit per employee (in thousands of dollars) for the company, segment, and market as a whole

Profit per employee (in thousands of dollars) of the company Polibeli Group Ltd (PLBL)

Polibeli Group (PLBL) is an Indonesian company apparently operating in the IT outsourcing or digital services space. It's a service business where people are the main asset. This chart will show how profitable their contracts are. It will measure the profit (margin) generated by each IT specialist or consultant working on client projects.

Profit per employee (in thousands of dollars) in the market segment - It outsourcing

Polibeli Group (PLBL) appears to operate in the IT outsourcing or digital services sector in Indonesia. In this sector, this metric is key. The chart shows the benchmark. PLBL's efficiency is the margin between the cost of their IT specialists and the price they charge their clients. They need to manage projects more effectively than their competitors to stay ahead of the average.

Profit per employee (in thousands of dollars) for the market as a whole

Polibeli Group (PLBL) is an IT outsourcing company. In this business, profit per employee is a key metric. It reflects the difference between how much the company pays its IT specialists and how much they "sell" their time to clients. Efficiency here means maximizing staff utilization.

Sales to employees of the company, segment and market as a whole

Sales per company employee Polibeli Group Ltd (PLBL)

Polibeli likely operates in IT outsourcing or e-commerce in Southeast Asia. This chart demonstrates the effectiveness of its business model. It measures the revenue each employee generates from services or sales, which is an indicator of scalability and market relevance in the region.

Sales per employee in the market segment - It outsourcing

Polibeli Group is an Indonesian company operating in the IT outsourcing and digital services sector. In this service-based business, this metric measures the revenue (billing) generated by each consultant or developer. This comparison with the industry demonstrates the demand for their services and the effectiveness of their pricing policy.

Sales per employee for the market as a whole

Polibeli Group is an Indonesian IT company providing outsourcing and software development services. It's a "people business." This chart shows how much revenue each employee (programmer, consultant) generates. It reflects the effectiveness of their service model and their ability to win and execute IT projects.

Short shares by company, segment and market as a whole

Shares shorted by company Polibeli Group Ltd (PLBL)

Polibeli Group is likely an Indonesian company operating in the IT services or e-commerce sectors. This chart shows bearish bets. Bears may be concerned about intense competition in the local market, regulatory risks, or slowing economic growth in the region, which could impact IT budgets or consumer spending.

Shares shorted by market segment - It outsourcing

Polibeli Group is an Indonesian company operating in the IT outsourcing and digital services sector. This chart shows overall short positions in the IT outsourcing sector. If it's high, investors expect companies to begin cutting spending on external IT contractors due to the economic downturn, which will impact the entire industry.

Shares shorted by the overall market

Polibeli (PLBL) is an Indonesian company. This business carries emerging market risks. When this indicator of *global* market pessimism rises, investors immediately "flight to quality." They sell off small, illiquid emerging market stocks en masse, like PLBL.

RSI 14 indicator for a company, segment, and market as a whole

The company's RSI 14 indicator Polibeli Group Ltd (PLBL)

Polibeli Group (PLBL) is an Indonesian IT outsourcing company. The business bears country risks and relies on corporate IT budgets. When this *global* pessimism indicator rises (<30), investors flee risky regions. A level above 70 indicates rare optimism for Indonesia/IT.

RSI 14 Market Segment - It outsourcing

Polibeli (PLBL) is an Indonesian IT outsourcing and consulting company. The IT outsourcing sector measures the pulse of the entire segment. It will show whether the sector as a whole is overheated, helping to separate PLBL's operational successes from the general hype surrounding IT services.

RSI 14 for the overall market

Polibeli Group, an IT outsourcing company, sees IT budgets in this graph. In a frenzy of euphoria, companies invest in growth and new projects by hiring outsourcers. In a panic, budgets are frozen, projects are canceled, and companies (like Polibeli) are laying off external staff, primarily to retain their full-time employees.

Analyst consensus forecast for the company's share price, the segment, and the market as a whole

Analyst consensus stock price forecast PLBL (Polibeli Group Ltd)

Polibeli Group Ltd is an IT outsourcing company. This chart shows the average target price. Analysts' forecasts are likely based on the company's ability to win software development or support contracts, regional labor rates, and overall demand for IT services in its target markets.

The difference between the consensus estimate and the actual stock price PLBL (Polibeli Group Ltd)

Polibeli Group is an Indonesian company providing IT services and outsourcing to businesses. This chart measures the gap between the current share price and the consensus target price. It shows whether experts believe in the growing demand for digitalization in the Indonesian economy and the company's ability to win contracts.

Analyst consensus forecast for stock prices by market segment - It outsourcing

Polibeli Group is an Indonesian IT company providing outsourcing and software development services to businesses in Southeast Asia. This chart reflects analysts' overall expectations for the IT outsourcing sector. It shows whether experts believe the IT services market in developing countries will grow or decline.

Analysts' consensus forecast for the overall market share price

Polibeli Group (PLBL) is likely an Indonesian company operating in IT outsourcing or digital services. It's a bet on digitalization in Southeast Asia. This chart shows the overall risk appetite, reflecting investors' willingness to invest in volatile tech companies in emerging markets.

AKIMA index of the company, segment and market as a whole

AKiMA Company Index Polibeli Group Ltd

Polibeli Group is likely an Indonesian company operating in IT outsourcing, software distribution, and e-commerce. This chart is a summary indicator of their business model. It reflects their ability to win contracts, their margins, and their positioning in the competitive and rapidly growing digital market of Southeast Asia.

AKIMA Market Segment Index - It outsourcing

Polibeli Group (PLBL) is an Indonesian company operating in the IT outsourcing and digital services sector. This chart shows the average index for the IT outsourcing sector. It helps investors assess how Polibeli's Asian-focused business model compares to the industry average.

The AKIM Index for the overall market

Polibeli Group is a B2B e-commerce platform in Indonesia that connects manufacturers with small retailers. This chart, showing the average (global/US) market figure, serves as a benchmark. It helps assess how this emerging market's digitalization of commerce compares to overall macroeconomic trends.